DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sgl and AT2G40116

DIOPT Version :9

Sequence 1:NP_476980.1 Gene:sgl / 38760 FlyBaseID:FBgn0261445 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_850327.2 Gene:AT2G40116 / 818602 AraportID:AT2G40116 Length:613 Species:Arabidopsis thaliana


Alignment Length:421 Identity:80/421 - (19%)
Similarity:133/421 - (31%) Gaps:125/421 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 KSTVPVRAAESIMHILRANQKPGIHYDILSNPEFLAEGTAINDLLN----ADRVLIGGEETPEGH 185
            :||....|...|..::|..     |:    ...|...|..::|..|    .|   :....||..|
plant    84 ESTTVAEAQRLIDEVIRRR-----HH----VTRFTRHGLDLDDFFNFLFYDD---LNPPITPHVH 136

  Fly   186 QAVEKLSWIYEHWIPKQNILTTNTWSSELSKLAANAFLAQRISSINSLSAVCEATGADV------ 244
            |.:......|..:....:.||.|..||:.|::.....| ||...:..|.....:||.|:      
plant   137 QDMTAPLSHYFIYTGHNSYLTGNQLSSDCSEVPVIKAL-QRGVRVIELDLWPNSTGTDINVLHGR 200

  Fly   245 ----------------------SEVARAVGLDSRIGSKFLQASVG------FGGSCFQKDILNLI 281
                                  |.....:.|:..: :..|||.|.      ||         .::
plant   201 TLTTPVPLMKCLKSIRDYAFSSSPYPVIITLEDHL-TPDLQAKVAEMATQIFG---------QML 255

  Fly   282 YICEN---LNLPEVAAYWQQVI----DMNEYQKRRFSQKIIESLFNTVSDKRIAILGFAFKKNTG 339
            |..|:   |..|..|:...::|    ...||.:.|  ..|::...|.||           ..:..
plant   256 YYPESDSLLEFPSPASLLHRIIISTKPPKEYLESR--NPIVKQKDNNVS-----------PSSED 307

  Fly   340 DTRETAAITVCQTLLEEGAALDIYDPKVEPEQIIDDLTHPSVTESPEKVKKAVQIHS-DPYSAVR 403
            :|..|..|...:::|        :|...|.:...|.....:..:.....|:.:.||: .|...|:
plant   308 ETPRTEEIQTLESML--------FDQDFESKSDSDQEDEEASEDQKPAYKRLITIHAGKPKGTVK 364

  Fly   404 ATHALVI----------------CTEWDE----FVDLDFKRIY-------QSMMKPAYIFDGRKI 441
            ....:|:                |:...:    |...:..|||       .|..||...:.    
plant   365 EEMKVVVDKVRRLSLSEQELDRTCSSNSQDVVRFTQRNLLRIYPKGTRFNSSNYKPLIGWT---- 425

  Fly   442 LDHERLQQIGFHVQTIGKK-YQRTGLLRSWG 471
               ...|.|.|::|..||. :...|:.|:.|
plant   426 ---HGAQMIAFNMQGYGKSLWLMHGMFRANG 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sglNP_476980.1 PLN02353 1..459 CDD:177986 75/406 (18%)
AT2G40116NP_850327.2 PLN02952 1..613 CDD:178538 80/421 (19%)
EF-hand_like 69..136 CDD:286375 13/63 (21%)
PI-PLCc_plant 136..452 CDD:176541 66/354 (19%)
C2_PLC_like 483..613 CDD:175974
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.