DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sgl and plcb2

DIOPT Version :9

Sequence 1:NP_476980.1 Gene:sgl / 38760 FlyBaseID:FBgn0261445 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_021323208.1 Gene:plcb2 / 569376 ZFINID:ZDB-GENE-080419-1 Length:1152 Species:Danio rerio


Alignment Length:390 Identity:76/390 - (19%)
Similarity:128/390 - (32%) Gaps:120/390 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 VNL----FFSTDIETAIKEADLIFISVNT-PTKTCGNGKGRAADLKYVESAARMIAEIAQSNKIV 122
            |||    ||:......:...|::.|:.|| ...:|   :....|..||...       .|:||  
Zfish   124 VNLTYHNFFAAKEVAQMWADDILAIAYNTLRANSC---RQLYLDKVYVRLT-------LQTNK-- 176

  Fly   123 VEKSTVPVRAAESIMHILRANQK-----------PGIHYDILSNPEF--LAEGTAINDLLNADRV 174
              ...:||:   :|..:..|::|           |...:|.:....|  .|..|.|.:|.     
Zfish   177 --DGKIPVK---NIFKMFPADKKRVDAALAAANLPRGKFDTIKTDVFTEAAFKTFIMNLC----- 231

  Fly   175 LIGGEETPEGHQAVEKLSWIYEHWIPKQNILTTNTWSSEL------SKLAANAFLAQRISSINSL 233
                 ..||       ::.|:..:...:..:|...::..|      |:|....|...|...:.||
Zfish   232 -----PRPE-------INDIFTSFTKGKGFMTKEMFAKFLNEKQRDSRLNEELFPPMRPEQVKSL 284

  Fly   234 SAVCEATGADVSEVARAVGLDSRIGSKFLQASVGFGGSCFQKDILNLIYICENLNLPEVAAY--- 295
            ....|.:.::.|.                       ..|.:|...:.||   .|.:.:..::   
Zfish   285 IEKYEPSSSNASR-----------------------SECARKHHSDTIY---RLTIDQYESFSEV 323

  Fly   296 --WQQVIDMNEYQKRRFSQKIIESLFNTVSDKRIAILGFAFKKNTGDTRETAAITVCQTLLEEGA 358
              .|.||           :.|.||.|.|  .|...:|.|....::...:|..| ..|:|:..:..
Zfish   324 FLLQDVI-----------EAIAESAFKT--SKYPVVLSFENHVDSVKQQEKMA-NYCRTIFGDAL 374

  Fly   359 ALDIYD--------PKVEPEQIIDDL--------THPSVTESPEKVKKAVQIHSDPYSAVRATHA 407
            .:|:.|        |...|.:::..:        ..||..| |.|...|.:..|||.....||.:
Zfish   375 LIDLLDKYPLKPGQPIPSPSELMGKILIKNKKSSAAPSKAE-PSKKPAAQEQTSDPAEGSEATQS 438

  Fly   408  407
            Zfish   439  438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sglNP_476980.1 PLN02353 1..459 CDD:177986 76/390 (19%)
plcb2XP_021323208.1 PH_PLC_beta 33..159 CDD:270167 10/37 (27%)
EFh_PI-PLC 164..299 CDD:333715 31/188 (16%)
EF-hand motif 164..193 CDD:320029 10/42 (24%)
EF-hand motif 197..225 CDD:320029 4/27 (15%)
EF-hand motif 235..263 CDD:320029 4/34 (12%)
PI-PLCc_beta <325..597 CDD:176533 30/129 (23%)
DUF4106 <406..548 CDD:315952 11/34 (32%)
C2_PLC_like 630..749 CDD:175974
DUF1154 915..958 CDD:310911
PLC-beta_C 985..1129 CDD:312287
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.