DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sgl and plcd4a

DIOPT Version :9

Sequence 1:NP_476980.1 Gene:sgl / 38760 FlyBaseID:FBgn0261445 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_694028.4 Gene:plcd4a / 565669 ZFINID:ZDB-GENE-050208-654 Length:761 Species:Danio rerio


Alignment Length:260 Identity:52/260 - (20%)
Similarity:83/260 - (31%) Gaps:74/260 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RAAESIMHILRANQKPGIHYDILSNPEFLAEGTAINDLLNADRVLIGGEETPEGHQAVEKLSWIY 195
            |..|..|.|...::|.|..:...|          :.|:          |...||||:...||...
Zfish    45 RLQEDCMTIWYQSKKAGNAHSTFS----------VGDV----------EAVREGHQSEVLLSIAD 89

  Fly   196 EHWIPKQNILTTNTWSSELSKLAANAFLAQRISSINSLSAVCEATGA-------------DVSEV 247
            |  .|.....|.             .|..:|    .:|..|.|:|..             ::..:
Zfish    90 E--FPPDRCFTL-------------VFRGRR----GNLDLVAESTKEAQSWIKGIRKLIDNLENM 135

  Fly   248 ARAVGLDSRIGSKFLQASVGFGGSCFQKDILNLIYICENLNLPEVAAYWQQVIDMNEYQKRRFSQ 312
            .:...||..|...|.:|.....|....|::.:|:.:..              :||||:...|...
Zfish   136 GQREKLDQWICDWFKKADKNRDGRMNFKEVRDLLKMMN--------------VDMNEHHALRLFT 186

  Fly   313 KIIESLFNTVSDKRIAILGFAFKKNTGDTRETAAITVCQTLLEEGAALDIYDPK--VEPEQIIDD 375
            ....|...|:.|....:    |.|..  |:....:.|.|....:|..|.:.|.|  ::.||:.:|
Zfish   187 MADRSQSGTLEDDEFVL----FYKML--TQREDILRVFQEYSADGQKLTLKDLKDFLQEEQLHED 245

  Fly   376  375
            Zfish   246  245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sglNP_476980.1 PLN02353 1..459 CDD:177986 52/260 (20%)
plcd4aXP_694028.4 PH_PLC_delta 24..139 CDD:270169 24/132 (18%)
PH 32..129 CDD:278594 24/122 (20%)
EF-hand_7 149..205 CDD:290234 13/73 (18%)
EF-hand_10 159..208 CDD:291454 12/66 (18%)
PLN02228 212..753 CDD:177873 9/34 (26%)
EF-hand_like 213..295 CDD:286375 9/33 (27%)
PI-PLCc_GDPD_SF 295..599 CDD:301322
C2_PLC_like 631..758 CDD:175974
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.