DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sgl and plcl1

DIOPT Version :9

Sequence 1:NP_476980.1 Gene:sgl / 38760 FlyBaseID:FBgn0261445 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_001921798.4 Gene:plcl1 / 563105 ZFINID:ZDB-GENE-090313-194 Length:1137 Species:Danio rerio


Alignment Length:220 Identity:47/220 - (21%)
Similarity:88/220 - (40%) Gaps:47/220 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 TAIKEADLIFISVNTPTKTCGNGKGRAADLKYVESAARMIAEIAQSNKIVVEKSTVPVRAAESIM 137
            |.||..|..|...:.|.:       .|.||:  |.|  |.|.:|......:.......:..:|:.
Zfish   925 TGIKVLDDTFRPASGPLR-------EATDLR--EDA--MCATVAFKELCGLPPMATLKQCIQSLA 978

  Fly   138 HILRA-NQKPGIHYDILSNPEFLAEGTAIND-----------LLNADRVLIGGEETPEGHQ---- 186
            ..|:: :..||....:.....||.....:.|           :::|::.||   |..:|.|    
Zfish   979 TRLQSPDGPPGATLTLKDGYPFLEPAANLTDATRKLLNGYDTMISANKQLI---ENADGVQEKIA 1040

  Fly   187 AVEKLSWIYEHWIP----KQNI--------LTTNTWSSELSKLAANAFLAQRISSINS---LSAV 236
            .|:|...::...:|    |:|:        :.:..|:..:.|...:...:.:|.::::   |:..
Zfish  1041 QVQKEGMVFHEDLPRLGEKENLKGRKQSKAVESFAWNITVLKGQCDLLRSAKIDALDTLRQLALA 1105

  Fly   237 CEATGADVSEVAR--AVGLDSRIGS 259
            |||:|..|:...:  :.||.||.||
Zfish  1106 CEASGLIVTSDGQYTSHGLSSRRGS 1130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sglNP_476980.1 PLN02353 1..459 CDD:177986 47/220 (21%)
plcl1XP_001921798.4 PH_PLC_eta 94..202 CDD:270170
PLN02952 302..889 CDD:178538
EF-hand_like 302..384 CDD:286375
PI-PLCc_GDPD_SF 384..734 CDD:301322
C2_PLC_like 766..894 CDD:175974
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.