DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sgl and plcd3b

DIOPT Version :9

Sequence 1:NP_476980.1 Gene:sgl / 38760 FlyBaseID:FBgn0261445 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_005156186.1 Gene:plcd3b / 562569 ZFINID:ZDB-GENE-081222-2 Length:769 Species:Danio rerio


Alignment Length:304 Identity:55/304 - (18%)
Similarity:93/304 - (30%) Gaps:125/304 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 SLSAVCEAT-------------GADVSEVARAVGLDSRIGSKFLQASVGFGGSCFQKDI------ 277
            ||...|:.|             ...|:.:.:...||:.|.....||.:...|....:::      
Zfish   120 SLDVQCDTTEEAQHWVHGIRTLQGRVNNMTQKEKLDNWIYGYLKQADINHDGKMSYEEVQVLFKL 184

  Fly   278 ----LNLIY-----------------------IC-ENLNLPEVAAYWQQ---------VIDMNEY 305
                ||..|                       .| |.|..||:.|.:||         .:|:.|:
Zfish   185 VNIDLNEEYAASLFKKSDKSADGRLEHEEIELFCRELLRRPELDAVFQQYSANGCVLSTVDLREF 249

  Fly   306 QKRRFSQKIIESLFNTVSDKRIAILGFAF----KKNTGDTRETAAITVCQTLLEEGAAL------ 360
            .|.:...       :|:...:..||.:..    :||             |.:...|..:      
Zfish   250 LKDQGED-------HTLVHAQSLILTYELNEWAQKN-------------QFMTANGFTMYMLSKE 294

  Fly   361 -DIYDPKVEPEQIIDDLTHP----SVTESPEKVKKAVQIHSD----PYSAVRATHALVICTEWDE 416
             |:|:|  :..::..|::||    .::.|........|:.||    ||  :||......|.|.| 
Zfish   295 NDVYNP--DHRRVYQDMSHPLSHYFISSSHNTYLTKDQLISDSSVHPY--IRALSQGCRCVELD- 354

  Fly   417 FVDLDFKRIYQSMMKPAYIFDGRKILDHERLQQIGFHVQTIGKK 460
                              .:||.|       :.:.:|..|:..|
Zfish   355 ------------------CWDGEK-------EPVIYHGHTLTSK 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sglNP_476980.1 PLN02353 1..459 CDD:177986 54/301 (18%)
plcd3bXP_005156186.1 PH-like 34..152 CDD:302622 5/31 (16%)
EF-hand_7 163..215 CDD:290234 6/51 (12%)
EF-hand_10 172..221 CDD:291454 4/48 (8%)
EF-hand_like 226..306 CDD:286375 17/101 (17%)
PLN02952 230..737 CDD:178538 35/194 (18%)
PI-PLCc_GDPD_SF 306..592 CDD:301322 20/96 (21%)
C2_PLC_like 624..752 CDD:175974
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.