DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sgl and plcd4b

DIOPT Version :9

Sequence 1:NP_476980.1 Gene:sgl / 38760 FlyBaseID:FBgn0261445 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_689964.4 Gene:plcd4b / 561475 ZFINID:ZDB-GENE-080512-3 Length:753 Species:Danio rerio


Alignment Length:241 Identity:44/241 - (18%)
Similarity:78/241 - (32%) Gaps:50/241 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 EETPEGHQAVEKLSWIYEHWIPKQNI-LTTNTWSSELSKLAANAFLAQR-ISSINSLSAVCEATG 241
            |...||||: |.|..:.:.:.|.:.. |........|..:|.:|..||. |..:..|.       
Zfish    67 EAVREGHQS-EALLGVADEFPPDRCFTLVFRGRKGNLDLVAESAEEAQAWIQGVRGLM------- 123

  Fly   242 ADVSEVARAVGLDSRIGSKFLQASVGFGGSCFQKDILNLIYICENLNLPEVAAYWQQVIDMNEYQ 306
            .::..:..:..||..|...|.:|.....|....|:...|:.:..              |||||  
Zfish   124 ENMENMDESTKLDQWISDWFSKADRNKDGRINFKEAKKLLKMMN--------------IDMNE-- 172

  Fly   307 KRRFSQKIIESLFNTVSDKRIAILGFAFKKNTGDTRETAAITVCQTLLEEGAALDIYDPKVEPEQ 371
                             :....:...|.|..:|...:...:...:.|.|....||::.......|
Zfish   173 -----------------EHACCLFKMADKSRSGTLEDQEFVEFYKMLTERREVLDLFQDYSSDGQ 220

  Fly   372 I-----IDDLTHPSVTESPEKVKKAVQI--HSDPYSAVRATHALVI 410
            |     :::.......|.....:.|:|:  ..:|....|..|::.:
Zfish   221 ILSQCDLEEFLREEQLEGESSYEHALQLIDRYEPSETARMNHSMSV 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sglNP_476980.1 PLN02353 1..459 CDD:177986 44/241 (18%)
plcd4bXP_689964.4 PH-like 18..130 CDD:302622 16/70 (23%)
PH 18..124 CDD:278594 16/64 (25%)
EF-hand_5 139..163 CDD:289945 5/23 (22%)
EF-hand_7 143..199 CDD:290234 13/88 (15%)
EF-hand_10 153..202 CDD:291454 10/81 (12%)
PLN02228 207..738 CDD:177873 10/60 (17%)
EF-hand_like 207..289 CDD:286375 10/60 (17%)
PI-PLCc_delta 289..584 CDD:176535
C2_PLC_like 616..743 CDD:175974
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.