DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sgl and plch2b

DIOPT Version :9

Sequence 1:NP_476980.1 Gene:sgl / 38760 FlyBaseID:FBgn0261445 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_017213827.1 Gene:plch2b / 560919 ZFINID:ZDB-GENE-101112-1 Length:1260 Species:Danio rerio


Alignment Length:360 Identity:63/360 - (17%)
Similarity:116/360 - (32%) Gaps:140/360 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 AAESIMHILRANQKPGIHY----------DILSNPEF----LAEGTAINDLLNADRVLIGGEETP 182
            |:.|||...:..||..|..          .|:::|::    :.|....|....:..:.:.|:.  
Zfish    37 ASPSIMTSPKLWQKAAISRLAEEFFWIGGSIVASPKWRMGQIVERCMCNMQAGSQMIKLRGKS-- 99

  Fly   183 EGHQAVEKLSWIYEH-----WIPKQNILTTNTWSSELSKLAANAFLAQRISSINSLSAVCEATGA 242
               :|:.:|.::.||     |.|.:        ..|.:|:           :|:|:..|||....
Zfish   100 ---KALVRLFYLDEHKSCIRWRPSR--------KHERAKI-----------TIDSIHEVCEGMRT 142

  Fly   243 DV--------------------------------SEVARA--VGL-------------------- 253
            :|                                .|.||.  .||                    
Zfish   143 EVFRRFANNNFDPNCCFSIYHGDHVESLDLVSTNGEEARTWITGLKYLLAGISDEDSLAKRQRTR 207

  Fly   254 DSRIGSKFLQASVGFGGSCFQKDILNLIYICENLNLP--EVAAYWQQVIDMNEYQKRRFSQKI-- 314
            |..:...|.:|.....|:....::|.|::.. |:|||  :|...:|:. |.:|.|.....::.  
Zfish   208 DQWLRQTFSEADKNGDGNLSIGEVLQLLHKL-NVNLPKQKVREMFQEA-DTDENQGSLTFEEFCT 270

  Fly   315 IESLFNTVSDKRIAILGFAFKKNTGDTR--------ETAAITV----CQTLLEE----------- 356
            ...|.:|..|..:.::.::..|...|..        |...:.|    |:.::.:           
Zfish   271 FYKLISTRRDLYLLMISYSNHKEHLDLNDLQRFLESEQKMVNVTKEYCKMIINQFEPCSQNQSHV 335

  Fly   357 ------------GAALDIYDPKVEPEQIIDDLTHP 379
                        ..|.||::|  |..|:..|:|.|
Zfish   336 VLGIDGFTNYMRSPAGDIFNP--EHYQVNQDMTQP 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sglNP_476980.1 PLN02353 1..459 CDD:177986 63/360 (18%)
plch2bXP_017213827.1 PH_PLC_eta 86..192 CDD:270170 20/129 (16%)
EFh_PI-PLC 210..350 CDD:333715 22/141 (16%)
EF-hand motif 210..239 CDD:320029 5/29 (17%)
EF-hand motif 246..275 CDD:320029 5/29 (17%)
EF-hand motif 280..308 CDD:320029 3/27 (11%)
EF-hand motif 317..350 CDD:320029 1/32 (3%)
PI-PLCc_GDPD_SF 362..719 CDD:326331 3/7 (43%)
C2_PLC_like 749..873 CDD:175974
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.