DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sgl and PLCL1

DIOPT Version :9

Sequence 1:NP_476980.1 Gene:sgl / 38760 FlyBaseID:FBgn0261445 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_006217.3 Gene:PLCL1 / 5334 HGNCID:9063 Length:1095 Species:Homo sapiens


Alignment Length:396 Identity:81/396 - (20%)
Similarity:138/396 - (34%) Gaps:143/396 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SSERIAQWNSDKLPIYEPG--LDEVVKKCRNVNLFFS--TDIETAIKEADLIFISVNTPTKTCGN 94
            |.::|:..| |.:...:.|  |.:|....|..|.||:  ||::....|          |:|    
Human   101 SEKKISSAN-DCISFMQAGCELKKVRPNSRIYNRFFTLDTDLQALRWE----------PSK---- 150

  Fly    95 GKGRAADLKYVESAARMIAEIAQSNKIVVEKSTVPVR-----------AAESIMHILRANQKPGI 148
                    |.:|.|.   .:|:...:|.:.|:|...|           .|.||:|        |.
Human   151 --------KDLEKAK---LDISAIKEIRLGKNTETFRNNGLADQICEDCAFSILH--------GE 196

  Fly   149 HY---DILSNPEFLAEGTAINDLLNADRVLIGGEETP----EGHQAVEKLSW---IYEHWIPKQN 203
            :|   |:::|...:|     |..::..|.|:...:.|    ||:|...:..|   ::|......|
Human   197 NYESLDLVANSADVA-----NIWVSGLRYLVSRSKQPLDFMEGNQNTPRFMWLKTVFEAADVDGN 256

  Fly   204 ILTTNTWSSELSK------------------LAANAFLAQRISSINSLSAVCE-ATGADVSEVAR 249
            .:.....|.||.|                  ..:...|..|::......|.|| .|..:|..:..
Human   257 GIMLEDTSVELIKQLNPTLKEAKIRLKFKEIQKSKEKLTTRVTEEEFCEAFCELCTRPEVYFLLV 321

  Fly   250 AVG-----LDSRIGSKFLQASVGFGGSCFQKDILNLIYICENLNLPEVAAYWQQVIDMNEYQKRR 309
            .:.     ||:.....||:|..|            :.:|.|::.|..:..|     :::|..:::
Human   322 QISKNKEYLDANDLMLFLEAEQG------------VTHITEDICLDIIRRY-----ELSEEGRQK 369

  Fly   310 -FSQKIIESLFNTVSDKRIAILGFAFKKNTGDTRETAAITVCQTLLEEGAALDIYDPKVEPEQII 373
             |                :||.||.                 |.||  .:..||:||  |.:::.
Human   370 GF----------------LAIDGFT-----------------QYLL--SSECDIFDP--EQKKVA 397

  Fly   374 DDLTHP 379
            .|:|.|
Human   398 QDMTQP 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sglNP_476980.1 PLN02353 1..459 CDD:177986 81/396 (20%)
PLCL1NP_006217.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..61
Interaction with PPP1C 83..222 35/159 (22%)
PH_PLC_eta 115..223 CDD:270170 32/145 (22%)
PH 118..223 CDD:278594 32/142 (23%)
EF-hand_like 315..396 CDD:286375 25/134 (19%)
PLN02228 330..850 CDD:177873 27/128 (21%)
PI-PLCc_PRIP_metazoa 398..688 CDD:176539 3/6 (50%)
Interaction with GABA A beta subunit. /evidence=ECO:0000250 543..567
C2_PLC_like 720..848 CDD:175974
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1066..1095
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.