DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sgl and PLCD1

DIOPT Version :9

Sequence 1:NP_476980.1 Gene:sgl / 38760 FlyBaseID:FBgn0261445 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001124436.1 Gene:PLCD1 / 5333 HGNCID:9060 Length:777 Species:Homo sapiens


Alignment Length:412 Identity:81/412 - (19%)
Similarity:134/412 - (32%) Gaps:127/412 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 IAQSNKIVVEKSTVPVRAAESIMHILRANQKPGIHYDILSNPE-----FLAEGTAINDLLNADRV 174
            ::..|...:|:..|..|...:|:..:..|:......:.|.:||     .|.:|..:..||..   
Human   408 LSLENHCTLEQQRVMARHLHAILGPMLLNRPLDGVTNSLPSPEQLKGKILLKGKKLGGLLPP--- 469

  Fly   175 LIGGEETPEG------HQAVEKLSWIYEHWI---PKQNILTTNTWSSELSKLAANAFLAQRISSI 230
              |||..||.      .:|.|.........:   ||::.|.                |||.:|  
Human   470 --GGEGGPEATVVSDEDEAAEMEDEAVRSRVQHKPKEDKLR----------------LAQELS-- 514

  Fly   231 NSLSAVCEAT-----------GADVSEVA-----RAVGLDSRIGSKFLQASVGFGGSCFQKDILN 279
             .:...|::.           |....|:|     ||:.|....|:.|::.:||.         |:
Human   515 -DMVIYCKSVHFGGFSSPGTPGQAFYEMASFSENRALRLLQESGNGFVRHNVGH---------LS 569

  Fly   280 LIYICENLNLPEVAAYWQQVIDMNEYQKRRF---SQKIIESLFNTVSDKRIAILGFAFKKNTGDT 341
            .||          .|.|:  .|.:.|.....   ..:|:...|.|...:.....| .|:.|    
Human   570 RIY----------PAGWR--TDSSNYSPVEMWNGGCQIVALNFQTPGPEMDVYQG-RFQDN---- 617

  Fly   342 RETAAITVCQTLLEEGAALD---IYDPKVEPE-----------QIIDDLTHPSVTESPEKV---K 389
                  ..|..:|:.....|   .::|:...:           ::|.....|.|.::...:   |
Human   618 ------GACGYVLKPAFLRDPNGTFNPRALAQGPWWARKRLNIRVISGQQLPKVNKNKNSIVDPK 676

  Fly   390 KAVQIHSDPYSAVRATHALVICTE------WD-EFV------DLDFKRI----YQSMMKPAYIFD 437
            ..|:||.  .|...|:....:.|.      || ||.      ||...|.    |.:..|..:|  
Human   677 VTVEIHG--VSRDVASRQTAVITNNGFNPWWDTEFAFEVVVPDLALIRFLVEDYDASSKNDFI-- 737

  Fly   438 GRKILDHERLQQIGFHVQTIGK 459
            |:..:....|:|...||..:.|
Human   738 GQSTIPLNSLKQGYRHVHLMSK 759

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sglNP_476980.1 PLN02353 1..459 CDD:177986 80/410 (20%)
PLCD1NP_001124436.1 PH_PLC_delta 43..160 CDD:270169
PH 51..151 CDD:278594
EF-hand_10 180..229 CDD:291454
PLN02228 233..776 CDD:177873 81/412 (20%)
EF-hand_like 234..316 CDD:286375
PI-PLCc_delta 316..617 CDD:176535 50/254 (20%)
C2_PLC_like 650..776 CDD:175974 26/114 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.