DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sgl and plcl5

DIOPT Version :9

Sequence 1:NP_476980.1 Gene:sgl / 38760 FlyBaseID:FBgn0261445 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_002661169.2 Gene:plcl5 / 327464 ZFINID:ZDB-GENE-030131-5675 Length:1122 Species:Danio rerio


Alignment Length:375 Identity:68/375 - (18%)
Similarity:118/375 - (31%) Gaps:139/375 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PGLDE-----------VVKKCRNVNLFFSTDIETAIK---EADLIFISVNTPTKTCGNGKGRAAD 101
            ||:.|           ..|.|....:...|.:|...:   .:::.|:.|..           :::
Zfish   289 PGMRESRIELKFKELQKAKDCYGEGIDLDTFVEAYCELCTRSEIFFLLVQF-----------SSN 342

  Fly   102 LKYVESAARMI-AEIAQSNKIVVEKSTVPVRAAESIMHILRANQKPGIHYDILSNPEFLAEGTAI 165
            .:|::|...|| .|:.|..:.|.|:      ....|:|    ..:|.            |||.. 
Zfish   343 KEYLDSKDLMIFVEVEQGVEGVTEE------MCREIVH----KYEPS------------AEGRN- 384

  Fly   166 NDLLNAD---RVLIGGE---ETPEGHQAV-----EKLSWIYEHWIPKQNILTTNTWSSELSKLAA 219
            |..|:.|   ..|:..|   ..|: |:.|     :.||..|.:.....::|..:.|.|       
Zfish   385 NGYLSIDGFTHYLLSSECHIFDPQ-HKHVCQDMTQPLSHYYINSSHNASLLEDHYWGS------- 441

  Fly   220 NAFLAQRISSINSLSAVCEATGADVSEVARAVGLDSRIGSKFLQASVGFGGSC-----FQKDILN 279
                                  :|:|...||:    |:|.:.|:..|..|..|     ....:.:
Zfish   442 ----------------------SDLSSYVRAL----RMGCRSLEVVVWDGPDCEPVVYVGSSVAS 480

  Fly   280 LIYICENLNLPEVAAYWQQVIDMNEYQKRRFSQKIIESLFNTVSDKRIAILGFAFKKNTGDTRET 344
            .:..|:.|::            :|:|........:|..|....|..:..::....||..||    
Zfish   481 QLAFCKILDV------------INQYAFESSEYPLILCLVTHCSVPQQRVMAQHLKKILGD---- 529

  Fly   345 AAITVCQTLLEEGAALDIYDPKVEPEQIIDDLTHPSVTESPEKVKKAVQI 394
                          .|.|..|.:|...:          .||:|:|..|.|
Zfish   530 --------------KLHIESPNLEDHYL----------PSPDKLKGKVLI 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sglNP_476980.1 PLN02353 1..459 CDD:177986 68/375 (18%)
plcl5XP_002661169.2 PH 131..239 CDD:278594
PH_PLC_eta 131..239 CDD:270170
PLN02228 324..872 CDD:177873 61/340 (18%)
EF-hand_like 331..413 CDD:286375 23/116 (20%)
PI-PLCc_PRIP_metazoa 413..710 CDD:176539 37/216 (17%)
C2_PLC_like 742..870 CDD:175974
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.