DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sgl and Plcl2

DIOPT Version :9

Sequence 1:NP_476980.1 Gene:sgl / 38760 FlyBaseID:FBgn0261445 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_038939092.1 Gene:Plcl2 / 301173 RGDID:1305941 Length:1128 Species:Rattus norvegicus


Alignment Length:165 Identity:32/165 - (19%)
Similarity:67/165 - (40%) Gaps:18/165 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 AINDLLNADRVLIGGEETP-----EGHQAVEKLSWIYEHW--IPKQNILTTNTWSSELSKLAANA 221
            ::.|::|  :......|.|     |.|.::::...:.:|.  |....:.||:....|....:.:.
  Rat   499 SVIDIIN--KYAFFASEYPLILCLENHCSIKQQKVMVQHMKKILGDKLYTTSPNMEESYLPSPDV 561

  Fly   222 FLAQRISSINSLSAVCEATGADVSEVARAVGLDSRIGSKFLQASVGFGGSCFQ--KDILNLIYIC 284
            ...:.:.....||:.|.....||::......:..|:|.:.::.........||  ||:..|:.||
  Rat   562 LKGKILIKAKKLSSNCSGVEGDVTDEDEGAEMSQRMGKENVEQPNHVPVKRFQLCKDLSELVSIC 626

  Fly   285 ENLNLPE------VAAYWQQVIDMNEYQKRRFSQK 313
            :::...|      |..|| :|...||....:::.:
  Rat   627 KSVQFKEFQVSFQVQKYW-EVCSFNEVLASKYANE 660

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sglNP_476980.1 PLN02353 1..459 CDD:177986 32/165 (19%)
Plcl2XP_038939092.1 PH_PLC_eta 144..252 CDD:270170
EFh_PRIP2 272..415 CDD:320053
EF-hand motif 272..301 CDD:320053
EF-hand motif 308..339 CDD:320053
EF-hand motif 344..372 CDD:320053
EF-hand motif 381..414 CDD:320053
PI-PLCc_PRIP_metazoa 426..722 CDD:176539 32/165 (19%)
C2_PLC_like 754..882 CDD:175974
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.