DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sgl and Plcd3

DIOPT Version :9

Sequence 1:NP_476980.1 Gene:sgl / 38760 FlyBaseID:FBgn0261445 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001099315.3 Gene:Plcd3 / 287745 RGDID:1310903 Length:785 Species:Rattus norvegicus


Alignment Length:324 Identity:70/324 - (21%)
Similarity:107/324 - (33%) Gaps:106/324 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 IAQSNKIVVEKSTVPVRAAESI---MHILRA--NQKPGIHYDILSNPE-----FLAEGTAINDLL 169
            ::..|...:|:..|..|...:|   |.:.:|  :|.|    :.|.:||     .|.:|..:....
  Rat   424 LSLENHCGLEQQIVMARHLRNILGDMLVTQALDSQNP----EELPSPEQLKCRVLVKGKKLPAAR 484

  Fly   170 NAD-RVLIGGEETPEGHQAVEKLSWIYEHWIPKQNILTTNTWSSELSKLAANAFLAQRIS-SINS 232
            |.| |:|...|:..|..:..|                       |..:.|.....|::|| .:::
  Rat   485 NEDGRILSDREDEDEDEEEAE-----------------------EALETAEQRKRAKQISPELSA 526

  Fly   233 LSAVCEATGADVSEVARAVGLDSRIGS-------KFLQASVGFGGSCFQKD---------ILNLI 281
            |...|.||.....|.:.......:|||       ||.:.:    |:.|.:.         .|.|.
  Rat   527 LVVYCCATRLRTLEPSPGPPQPCKIGSLSERKARKFTREA----GTSFVRHNTQQLTRVYPLGLR 587

  Fly   282 YICENLNLPEVAAYWQ---QVIDMNEYQKRRFSQKIIESLFNTVSDKRIAI---LGFAFKK---- 336
            ....|.|..|:   |.   |::.:|      |.....|...||   .|..|   .|:..|.    
  Rat   588 MTSANYNPQEM---WNSGCQLVALN------FQTPGYEMDLNT---GRFLINGQCGYVLKPAYLR 640

  Fly   337 --NT-------GDTRETAAITV--CQTLLEEGAALDIYDPKV---EPEQIIDDLTHPSVTESPE 386
              ||       |..|.|..:.|  .|.|           ||:   :|..|:|.|....:...||
  Rat   641 QLNTTFDPECPGPPRTTLTVQVLTAQQL-----------PKLNVEKPNSIVDPLVRVEIYGVPE 693

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sglNP_476980.1 PLN02353 1..459 CDD:177986 70/324 (22%)
Plcd3NP_001099315.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.