DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sgl and Plch1

DIOPT Version :9

Sequence 1:NP_476980.1 Gene:sgl / 38760 FlyBaseID:FBgn0261445 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_006501593.1 Gene:Plch1 / 269437 MGIID:2683547 Length:1694 Species:Mus musculus


Alignment Length:415 Identity:74/415 - (17%)
Similarity:144/415 - (34%) Gaps:115/415 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 KGRAADLKYVESAARMIAEIAQSNKIVVEKSTVPVRAAESIMHILRANQKPGI------HYDILS 154
            |||||....:...:.:.::|...:...:.:.|......:.:. :...||....      .::..:
Mouse  1153 KGRAATSFSLSDVSALCSDIPDLHSTAILQDTEISNLIDDVT-LTNENQSGSSISALIGQFEESN 1216

  Fly   155 NPEFLAEGTAINDLLNADRVLIGGEETPEGH---QAVEKLSWIYEHWIPKQNILTTNTWSSELSK 216
            :|   |..|.::.|..:........:||..|   |..:|.|::...  |:.|.|:    |.|.:|
Mouse  1217 HP---ANVTVVSHLSTSGASGSAPFQTPFKHGLSQGNQKASFLCSS--PELNKLS----SVETTK 1272

  Fly   217 LAANA----FLAQRIS--------SINSLSAVCEAT------------------GADVSEVARAV 251
            ||.||    .:...||        |..:.:.|.|..                  |.|.|:|..:.
Mouse  1273 LANNAVPCGVIGSPISTPKPGDDPSDKAKTRVIEGNLPGFPDASPGQFPKSPTHGEDHSQVMNSP 1337

  Fly   252 GLDSRIGSKFLQASVGFGGSCFQKDILNLIYICENLNLP-----EVAAYWQQVIDMNEYQKRRFS 311
            .|.:.:..:.:.|......:..:..::.:....|||:|.     |.|.  .|::...:.|:   |
Mouse  1338 ALSTELAIEDIIADPALSINSAESSLVEIDGESENLSLTTCDYREEAP--SQLVSPLKLQQ---S 1397

  Fly   312 QKIIE------------------SLFNTV------SDKRIAILGFAFKKNTGDTRETAAITVCQT 352
            |:::|                  .:||.:      |...:...|..|..|...:.:.....:|:.
Mouse  1398 QEMVEHIQRGLRNGYCKETLLPSEIFNNIPGVKNHSISHLTYQGAGFVYNHFSSSDAKTNQICEP 1462

  Fly   353 LLEEGAALDIYDPKVEPEQIIDDLTHPSVT----ESPEKVKKAVQIHSDPYSAVRATHALVICTE 413
              ::..|.|::.|...|.      ||..:.    .||.|.|....:.|:.          :.|  
Mouse  1463 --QQPRAPDMHAPTPTPS------THAPLAALKLPSPCKSKSLGDLTSED----------IAC-- 1507

  Fly   414 WDEFVDLDFKRIYQSMMKPAYIFDG 438
                   :|:..||.:.: :::.:|
Mouse  1508 -------NFESKYQCISR-SFVTNG 1524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sglNP_476980.1 PLN02353 1..459 CDD:177986 74/415 (18%)
Plch1XP_006501593.1 PH-like 34..140 CDD:388408
EFh_PI-PLCeta1 158..298 CDD:320050
EF-hand motif 158..187 CDD:320050
EF-hand motif 194..223 CDD:320050
EF-hand motif 228..256 CDD:320050
EF-hand motif 265..298 CDD:320050
PI-PLCc_eta1 310..714 CDD:176569
C2_PLC_like 744..868 CDD:175974
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.