DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sgl and Plcd1

DIOPT Version :9

Sequence 1:NP_476980.1 Gene:sgl / 38760 FlyBaseID:FBgn0261445 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_006244125.1 Gene:Plcd1 / 24655 RGDID:3346 Length:783 Species:Rattus norvegicus


Alignment Length:204 Identity:39/204 - (19%)
Similarity:77/204 - (37%) Gaps:60/204 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 LQASVGFGGSCFQKDIL-NLIYIC---------ENLNLPEVAAYWQQV-IDMNEYQKRRFSQKII 315
            |:..:...||..|:..| :.|:.|         ..:|..|:..:.::: |.:::...|:..::..
  Rat   125 LRKIIHHSGSMDQRQKLQHWIHSCLRKADKNKDNKMNFKELKDFLKELNIQVDDGYARKIFRECD 189

  Fly   316 ESLFNTVSDKRI----------AILGFAFKKNTGDTRETAAITVCQTLL-------EEGAALDI- 362
            .|..:::.|:.|          |.:..||::..| :.||.::....|.|       |.|.||.: 
  Rat   190 HSQTDSLEDEEIETFYKMLTQRAEIDRAFEEAAG-SAETLSVERLVTFLQHQQREEEAGPALALS 253

  Fly   363 ----YDPKVEPEQIIDDLTHPSVTESPEKVKKAVQIHSDPYSAVRATHALVICTEWDEFVDLDFK 423
                |:|.                   |..|...|:..|.:.      ..::..:.:.| .|..:
  Rat   254 LIERYEPS-------------------ETAKAQRQMTKDGFL------MYLLSADGNAF-SLAHR 292

  Fly   424 RIYQSMMKP 432
            |:||.|.:|
  Rat   293 RVYQDMDQP 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sglNP_476980.1 PLN02353 1..459 CDD:177986 39/204 (19%)
Plcd1XP_006244125.1 PH_PLC_delta 22..139 CDD:270169 4/13 (31%)
PH 30..130 CDD:278594 1/4 (25%)
EF-hand_10 159..208 CDD:291454 7/48 (15%)
PLN02952 213..778 CDD:178538 24/116 (21%)
EF-hand_like 213..295 CDD:286375 20/108 (19%)
PI-PLCc_delta 295..596 CDD:176535 4/7 (57%)
C2_PLC_like 628..782 CDD:175974
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.