DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sgl and Plcb1

DIOPT Version :9

Sequence 1:NP_476980.1 Gene:sgl / 38760 FlyBaseID:FBgn0261445 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001071109.1 Gene:Plcb1 / 24654 RGDID:3344 Length:1216 Species:Rattus norvegicus


Alignment Length:174 Identity:44/174 - (25%)
Similarity:65/174 - (37%) Gaps:42/174 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 YIC------ENLNLPEVAAYWQQVIDMNEYQKRRFSQKIIESLFNTV--------SDKRIAILGF 332
            |||      :.|.||.|..|    |::.:|....::. :||:|.|.:        ..|::|.|..
  Rat   773 YICLRNERNQPLMLPAVFVY----IEVKDYVPDTYAD-VIEALSNPIRYVNLMEQRAKQLAALTL 832

  Fly   333 ----AFKK--NTGDTRETAAITVCQTLLEEG----AALDIYDPKVEPEQIIDDLTHPSVTESPEK 387
                ..||  :.|:|...|......|..|.|    |.|   .|| .|.|.......|...::|.|
  Rat   833 EDEEEVKKEADPGETSSEAPSETRTTPAENGVNHTATL---APK-PPSQAPHSQPAPGSVKAPAK 893

  Fly   388 VKKAVQIHSDPYSAVRATHALVI--CTEWDEFVDLDFKRIYQSM 429
            .:..:|      |.:....|..|  ..:...||.|. |:.|:.|
  Rat   894 TEDLIQ------SVLTEVEAQTIEELKQQKSFVKLQ-KKHYKEM 930

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sglNP_476980.1 PLN02353 1..459 CDD:177986 44/174 (25%)
Plcb1NP_001071109.1 PH_PLC_beta 22..148 CDD:270167
PLN02952 216..784 CDD:178538 3/10 (30%)
EF-hand_like 224..314 CDD:286375
PI-PLCc_beta 316..643 CDD:176533
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 469..534
C2_PLC_like 677..796 CDD:175974 9/26 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 834..891 15/60 (25%)
DUF1154 903..939 CDD:284131 8/29 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 967..989
PLC-beta_C 1003..1172 CDD:285865
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1072..1095
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1172..1216
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.