DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sgl and PLCB1

DIOPT Version :9

Sequence 1:NP_476980.1 Gene:sgl / 38760 FlyBaseID:FBgn0261445 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_056007.1 Gene:PLCB1 / 23236 HGNCID:15917 Length:1216 Species:Homo sapiens


Alignment Length:171 Identity:42/171 - (24%)
Similarity:64/171 - (37%) Gaps:36/171 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 YIC------ENLNLPEVAAYWQQVIDMNEYQKRRFSQKIIESLFNTV--------SDKRIAILGF 332
            |||      :.|.||.|..|    |::.:|....::. :||:|.|.:        ..|::|.|..
Human   773 YICLRNERNQPLTLPAVFVY----IEVKDYVPDTYAD-VIEALSNPIRYVNLMEQRAKQLAALTL 832

  Fly   333 ----AFKK--NTGDTRETAAITVCQTLLEEGA-ALDIYDPKVEPEQIIDDLTHPSVTESPEKVKK 390
                ..||  :.|:|...|......|..|.|. ......|| .|.|.:.....|...::|.|.:.
Human   833 EDEEEVKKEADPGETPSEAPSEARTTPAENGVNHTTTLTPK-PPSQALHSQPAPGSVKAPAKTED 896

  Fly   391 AVQIHSDPYSAVRATHALVI--CTEWDEFVDLDFKRIYQSM 429
            .:|      |.:....|..|  ..:...||.|. |:.|:.|
Human   897 LIQ------SVLTEVEAQTIEELKQQKSFVKLQ-KKHYKEM 930

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sglNP_476980.1 PLN02353 1..459 CDD:177986 42/171 (25%)
PLCB1NP_056007.1 PH_PLC_beta 22..148 CDD:270167
EFh_PI-PLCbeta1 153..303 CDD:320038
EF-hand motif 153..182 CDD:320038
EF-hand motif 186..215 CDD:320038
EF-hand motif 224..253 CDD:320038
EF-hand motif 270..303 CDD:320038
PI-PLCc_beta 316..643 CDD:176533
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 469..534
C2_PLC_like 677..796 CDD:175974 9/26 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 834..891 13/57 (23%)
DUF1154 903..939 CDD:369010 8/29 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 963..994
PLC-beta_C 1003..1172 CDD:370077
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1071..1095
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1173..1216
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.