DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sgl and Plcd1

DIOPT Version :9

Sequence 1:NP_476980.1 Gene:sgl / 38760 FlyBaseID:FBgn0261445 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001280577.1 Gene:Plcd1 / 18799 MGIID:97614 Length:782 Species:Mus musculus


Alignment Length:355 Identity:83/355 - (23%)
Similarity:118/355 - (33%) Gaps:89/355 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 LSNPEFLAE-----GTAINDLLNADRVLIGGEETPEG------HQAVEKLSWIYEHWI---PKQN 203
            |.:||.|.|     |..:..||.|     |||..||.      .:|.|.........:   ||::
Mouse   451 LPSPEQLKEKILLKGKKLGGLLPA-----GGENGPEATDVSDEDEAAEMEDEAVRSQVQHKPKED 510

  Fly   204 ILTTNTWSSELSKLAANAFLAQRISSINSLSAVCEATGADVSEVARAVGLDSRIGSKFLQASVGF 268
            .|......|::.....:.......|...|..|..|.  |..|| :||:.|....|:.|::.:||.
Mouse   511 KLKLVPELSDMVIYCKSVHFGGFSSPSTSGQAFYEM--ASFSE-SRALRLLQESGNSFVRHNVGH 572

  Fly   269 GGSCFQKDILNLIYICENLNLPEVAAYWQQVIDMNEYQKRRF---SQKIIESLFNTVSDKRIAIL 330
                     |:.||          .|.|:  .|.:.|.....   ..:|:...|.|...:....|
Mouse   573 ---------LSRIY----------PAGWR--TDSSNYSPVEMWNGGCQIVALNFQTPGPEMDVYL 616

  Fly   331 GFAFKKNTG-------------DTRETAAITVCQTLLEEGAALDIYDPKVEPEQIIDDLTHPSVT 382
            | .|:.|.|             ||      |.....|.:|   ..:.||.....||.....|.|.
Mouse   617 G-CFQDNGGCGYVLKPAFLRDPDT------TFNSRALTQG---PWWAPKKLRVWIISGQQLPKVN 671

  Fly   383 ESPEKV---KKAVQIHSDPYSAVRATHALV----ICTEWD---EFV----DLDFKRI----YQSM 429
            ::...:   |..|:||...........|::    ....||   |||    ||...|.    |.|.
Mouse   672 KNKNSIVDPKVIVEIHGVGQDVASRQTAVITNNGFNPRWDTEFEFVVAVPDLALVRFMVEDYDSS 736

  Fly   430 MKPAYIFDGRKILDHERLQQIGFHVQTIGK 459
            .|..:|  |:..:....|:|...||..:.|
Mouse   737 SKNDFI--GQSTIPWNSLKQGYRHVHLLSK 764

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sglNP_476980.1 PLN02353 1..459 CDD:177986 82/353 (23%)
Plcd1NP_001280577.1 PH_PLC_delta 48..165 CDD:270169
PH 56..155 CDD:278594
EF-hand_10 185..234 CDD:291454
PLN02952 239..777 CDD:178538 83/355 (23%)
EF-hand_like 239..321 CDD:286375
PI-PLCc_delta 321..622 CDD:176535 47/200 (24%)
C2_PLC_like 654..781 CDD:175974 29/113 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.