DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sgl and plc-4

DIOPT Version :9

Sequence 1:NP_476980.1 Gene:sgl / 38760 FlyBaseID:FBgn0261445 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_501213.1 Gene:plc-4 / 177525 WormBaseID:WBGene00004039 Length:751 Species:Caenorhabditis elegans


Alignment Length:347 Identity:63/347 - (18%)
Similarity:129/347 - (37%) Gaps:64/347 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 DLKYVESAARMIAEIAQSNKIVVEKSTVPVRAAESIMHILRANQKPGIHYDILSNPEFLAEGTAI 165
            :|::.|..: ::..|  .|:.|.|.:.|.:::.:.:      |......::.:.|   ..:..|:
 Worm    24 ELEWAEKGS-LLCRI--KNQKVKEMALVTIKSKQFL------NYYSSYWFNFVPN---ALKSVAL 76

  Fly   166 NDLLNADRVLIGGEETPEGHQAVEK------------LSWIYEHWIPKQNILTTNTWSSELSKLA 218
            ::||.    :..|.:|....:|.:|            .|.|:.|    ...|..:...|..||..
 Worm    77 SELLE----VRSGYQTDNLQRASKKYEFQELAPESRCFSVIFSH----AKFLHKSVDFSADSKET 133

  Fly   219 ANAFLAQRISSINSLSAVCEATGADVSEVARAVGLDSRIGSKFLQASVGFGGSCFQKDILNLIYI 283
            .:.:    :|.:..|.:|.:......:|.|..:       .||.||.....|.....::.||:  
 Worm   134 RDKW----VSVLTHLISVAKHQRVVFNETAWLI-------DKFQQADTNKNGLLSFDEVWNLL-- 185

  Fly   284 CENLNLPEVAAYWQQVIDMNEYQKRR---FSQKIIESLFNTVSDKRIAILGFAFKKNTGDTRETA 345
             :.:||.....|.:.:...:|::..|   .::|...:.|..::|:  ..|.|...:.:.|..||.
 Worm   186 -KRMNLQISERYAKAIFRESEFENSRDNKLNEKEFLNFFERLTDR--PDLRFVMTQASSDNVETL 247

  Fly   346 AITVCQTLLEEGAALDIYDPKVEPEQIIDDLTHPSVTESPEKVKKAVQIHSDPYSAVRATHALVI 410
            .:...|..|.|....:..|.| :.|||:.........:..||:...:.:..            ::
 Worm   248 TVADLQRFLTEEQGFENVDLK-KAEQILTTFEQTVQDKQKEKLMGLMGMRR------------LM 299

  Fly   411 CTEWDEFVDLDFKRIYQSMMKP 432
            .:.|........:.|:|.|.:|
 Worm   300 QSRWGNVFKPGHESIFQDMDQP 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sglNP_476980.1 PLN02353 1..459 CDD:177986 63/347 (18%)
plc-4NP_501213.1 PH-like 29..145 CDD:302622 23/139 (17%)
EF-hand_7 161..223 CDD:290234 13/71 (18%)
EF-hand_10 176..226 CDD:291454 9/52 (17%)
PLN02228 221..751 CDD:177873 22/116 (19%)
EF-hand_like 231..315 CDD:286375 16/96 (17%)
PI-PLCc_eukaryota 315..596 CDD:176501 3/7 (43%)
C2_PLC_like 621..748 CDD:175974
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.