DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sgl and Plcz1

DIOPT Version :9

Sequence 1:NP_476980.1 Gene:sgl / 38760 FlyBaseID:FBgn0261445 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_006506962.1 Gene:Plcz1 / 114875 MGIID:2150308 Length:689 Species:Mus musculus


Alignment Length:141 Identity:27/141 - (19%)
Similarity:60/141 - (42%) Gaps:18/141 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 VSDKRIAILGFAFKKNTGDTRETAAITVCQTLLEEG--------AALDIYDPKVEPEQIIDDLTH 378
            |.::::..|....:: .|..:....:...:.:.|:|        ...|::..:::.|:..|..|.
Mouse   304 VKNRKVGTLSETHER-IGTDKSGQVLEWKEVIYEDGDEDSGMDPETWDVFLSRIKEEREADPSTL 367

  Fly   379 PSVTESPEKVKKAVQIHSDPYSAVRATHALVICTEWDEFVDLDFKRIYQSMMKPAYIFDGR-KIL 442
            ..:. ..:|.|:.::|       ..|...|||.|:.::|.:..:.|:||...:...|.:.| :.|
Mouse   368 SGIA-GVKKRKRKMKI-------AMALSDLVIYTKAEKFRNFQYSRVYQQFNETNSIGESRARKL 424

  Fly   443 DHERLQQIGFH 453
            ...|:.:..||
Mouse   425 SKLRVHEFIFH 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sglNP_476980.1 PLN02353 1..459 CDD:177986 27/141 (19%)
Plcz1XP_006506962.1 EF-hand_7 21..73 CDD:372618
PLN02952 79..614 CDD:178538 27/141 (19%)
PI-PLCc_GDPD_SF 162..489 CDD:387364 27/141 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.