DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment sgl and plch2a

DIOPT Version :9

Sequence 1:	NP_476980.1	Gene:	sgl / 38760	FlyBaseID:	FBgn0261445	Length:	476	Species:	Drosophila melanogaster
Sequence 2:	XP_009302541.1	Gene:	plch2a / 100334231	ZFINID:	ZDB-GENE-030131-6367	Length:	1557	Species:	Danio rerio

Alignment Length:	121	Identity:	24/121 - (19%)
Similarity:	39/121 - (32%)	Gaps:	33/121 - (27%)

- Green bases have known domain annotations that are detailed below.

  Fly   323 SDKRIAILGFAFKKNTGDTRETAAITVCQTLLEEGAALDIYDPKVEPEQIID------------- 374
            |.:||..|...|.::.|.:.:|...|..:....||.......|.|.||...|
Zfish  1184 SSQRIQALKAVFDRDIGRSMQTGLRTPVRRSKSEGQMKKADGPSVVPEVCTDATLNDRLWSKLDP 1248

  Fly   375 --------------------DLTHPSVTESPEKVKKAVQIHSDPYSAVRATHALVI 410
                                ||:.|:::........|.:.:||..:::...|..||
Zfish  1249 SSHRDSVSSSSSISSNDTVIDLSLPNLSRKSLTCLSAARDYSDKQASLTNNHRSVI 1304

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
sgl	NP_476980.1	PLN02353	1..459	CDD:177986	24/121 (20%)
plch2a	XP_009302541.1	PH_PLC_eta	86..192	CDD:270170
		EFh	210..276	CDD:238008
		EF-hand_7	211..272	CDD:290234
		PLN02952	252..910	CDD:178538
		EF-hand_like	280..361	CDD:286375
		PI-PLCc_GDPD_SF	362..770	CDD:301322
		C2_PLC_like	800..924	CDD:175974
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	0	0.000