DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10075 and CBP3

DIOPT Version :9

Sequence 1:NP_648064.1 Gene:CG10075 / 38758 FlyBaseID:FBgn0035722 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_015109.1 Gene:CBP3 / 855886 SGDID:S000006136 Length:335 Species:Saccharomyces cerevisiae


Alignment Length:154 Identity:49/154 - (31%)
Similarity:77/154 - (50%) Gaps:9/154 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 ESVADKINYVTFFRDFNLPNTFNSWFLVTELHVWLLLMRSMAEGSETGEDGRFLRNCIVEAMWGD 157
            |.:::...|  |:.|..||.||:.||.:|.||.|:|.:|..|...:.   ||..:..:|:..:.|
Yeast   134 EPLSETAKY--FYEDLKLPRTFSQWFQITVLHEWILFVRMRAMPFKY---GRNYQQKLVDRTFSD 193

  Fly   158 VNTRAKKLGAHNPSRTRQQ-IETLSEQFQAALIAYDEGIMSDDRVLACALWRRFF--EMNCDDYA 219
            :..|..:....|..|...| ::..:.|.:.|:.|||||..:||..||.|:||..|  ..|. |..
Yeast   194 IELRLFEEMKVNSGRIADQYLKDFNTQLRGAIFAYDEGFATDDGTLATAVWRNLFGGRKNI-DMV 257

  Fly   220 QIERLVKYVRQQASMLDSLPRDQF 243
            .:|.:|:|:..|..:|..|...:|
Yeast   258 HLESVVRYIYSQLYVLSRLSDREF 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10075NP_648064.1 Ubiq_cyt_C_chap 106..245 CDD:281912 46/141 (33%)
CBP3NP_015109.1 Ubiq_cyt_C_chap 146..286 CDD:397883 46/140 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344495
Domainoid 1 1.000 75 1.000 Domainoid score I2141
eggNOG 1 0.900 - - E1_KOG2873
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004756
OrthoInspector 1 1.000 - - oto99863
orthoMCL 1 0.900 - - OOG6_103736
Panther 1 1.100 - - LDO PTHR12184
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R171
SonicParanoid 1 1.000 - - X3909
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.