DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10075 and UQCC1

DIOPT Version :9

Sequence 1:NP_648064.1 Gene:CG10075 / 38758 FlyBaseID:FBgn0035722 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_011527179.1 Gene:UQCC1 / 55245 HGNCID:15891 Length:313 Species:Homo sapiens


Alignment Length:208 Identity:78/208 - (37%)
Similarity:119/208 - (57%) Gaps:9/208 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 NTNKTKPGTAEAAEGGILKRVLNKVGFT---PNTKARLKVTSHLLYESVADKINYVTFFRDFNLP 111
            :|.|..|...|...|...| ::..:|||   ..:|.::|:.:..:|.|..:|.::..||....:|
Human    91 STTKDSPQPVEEKVGAFTK-IIEAMGFTGPLKYSKWKIKIAALRMYTSCVEKTDFEEFFLRCQMP 154

  Fly   112 NTFNSWFLVTELHVWLLLMRSMAEGSETGEDGRFLRNCIVEAMWGDVNTRAKKLGAHNPSRTRQQ 176
            :|||||||:|.||||:.|:|...|    |..|:::...||..||.||..|.:.:|. ||...::.
Human   155 DTFNSWFLITLLHVWMCLVRMKQE----GRSGKYMCRIIVHFMWEDVQQRGRVMGV-NPYILKKN 214

  Fly   177 IETLSEQFQAALIAYDEGIMSDDRVLACALWRRFFEMNCDDYAQIERLVKYVRQQASMLDSLPRD 241
            :..::..|.||::.|||||:|||..||.||||.||...|:|...:|.||:|||:|...|||:..:
Human   215 MILMTNHFYAAILGYDEGILSDDHGLAAALWRTFFNRKCEDPRHLELLVEYVRKQIQYLDSMNGE 279

  Fly   242 QFIVKPKVAWLEL 254
            ..::..:|:|..|
Human   280 DLLLTGEVSWRPL 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10075NP_648064.1 Ubiq_cyt_C_chap 106..245 CDD:281912 59/138 (43%)
UQCC1XP_011527179.1 Ubiq_cyt_C_chap 150..285 CDD:281912 59/139 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150784
Domainoid 1 1.000 121 1.000 Domainoid score I5731
eggNOG 1 0.900 - - E1_KOG2873
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H14709
Inparanoid 1 1.050 148 1.000 Inparanoid score I4414
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46436
OrthoDB 1 1.010 - - D1428265at2759
OrthoFinder 1 1.000 - - FOG0004756
OrthoInspector 1 1.000 - - oto90540
orthoMCL 1 0.900 - - OOG6_103736
Panther 1 1.100 - - LDO PTHR12184
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R171
SonicParanoid 1 1.000 - - X3909
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.