DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10075 and cbp3

DIOPT Version :9

Sequence 1:NP_648064.1 Gene:CG10075 / 38758 FlyBaseID:FBgn0035722 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_588073.1 Gene:cbp3 / 2539468 PomBaseID:SPCC4B3.17 Length:283 Species:Schizosaccharomyces pombe


Alignment Length:143 Identity:44/143 - (30%)
Similarity:70/143 - (48%) Gaps:5/143 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 FFRDFNLPNTFNSWFLVTELHVWLLLMRSMAEGSETGEDGRFLRNCIVEAMWGDVNTRAKKLGAH 168
            :::...:|.||.|||.:|:||:|:|..|  ..|....|...| ...:....:.|:..|..|....
pombe   126 WYQKCEIPMTFQSWFQITQLHLWILHTR--IRGLPKNEKVAF-SQALTTRFFEDMELRIHKDYRI 187

  Fly   169 NPSR-TRQQIETLSEQFQAALIAYDEGIMSDDRVLACALWRRFFEMNCD-DYAQIERLVKYVRQQ 231
            |.:| :...::.|.:|...|:..||:|::..|.|||.::||..|....| |...:|.:||::|..
pombe   188 NSNRISGMYLKDLFQQQTGAIFGYDQGMLGSDAVLATSVWRNLFVGRPDVDLVILETIVKFIRLN 252

  Fly   232 ASMLDSLPRDQFI 244
            ...|..|..|.||
pombe   253 VYRLSCLSTDDFI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10075NP_648064.1 Ubiq_cyt_C_chap 106..245 CDD:281912 44/141 (31%)
cbp3NP_588073.1 Ubiq_cyt_C_chap 128..268 CDD:281912 44/141 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 69 1.000 Domainoid score I2703
eggNOG 1 0.900 - - E1_KOG2873
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004756
OrthoInspector 1 1.000 - - oto101549
orthoMCL 1 0.900 - - OOG6_103736
Panther 1 1.100 - - LDO PTHR12184
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R171
SonicParanoid 1 1.000 - - X3909
TreeFam 1 0.960 - -
109.800

Return to query results.
Submit another query.