DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9948 and CG42526

DIOPT Version :9

Sequence 1:NP_001261492.1 Gene:CG9948 / 38757 FlyBaseID:FBgn0035721 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001163401.1 Gene:CG42526 / 8674075 FlyBaseID:FBgn0260431 Length:245 Species:Drosophila melanogaster


Alignment Length:218 Identity:51/218 - (23%)
Similarity:87/218 - (39%) Gaps:56/218 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FDFKLIDLVEPNPVLYKRSGLSNYDAMKAKTDIWARIAEMMGCDVDFCLMRWNNLHYQFRKEFRR 75
            ||..||..|:.|..::::.. :.||..:|    |..:|:.....|::|.:||.:|..::.:|.::
  Fly     4 FDALLIASVKRNVSIFEKYH-TRYDRKQA----WIAVAQACQKSVEYCQIRWKSLRDRYVRETQK 63

  Fly    76 ADTSGSTWPYLERLRFLAEIQPPSKVKTKP-------KTNK---QEATIQTETPVQFLWDTFEDG 130
            ...:.|.....:.|.||.|   ..:::.||       .|||   ...|:.:::..:...:  .:|
  Fly    64 PAATRSNIRKFKELDFLRE---HIRIRRKPNELCNTLNTNKTLVPGVTVDSQSADELALE--RNG 123

  Fly   131 DVPQQSSTFIIE----------------EVIEEPSEQIIQEEIIY----------EEQEPAEIIS 169
            ....|...||||                |.|.|.|...|..|:.|          :.|..|:.:|
  Fly   124 ITEFQPDEFIIEYKGEEEYLSETDNSSAEFISEDSACNIGSELPYVTKPSFNGEGQSQTQAKFMS 188

  Fly   170 PRSSFLQMDQILAQLK----EPQ 188
                  .|:.|.:.||    |||
  Fly   189 ------VMNLIESALKDKPAEPQ 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9948NP_001261492.1 MADF 14..95 CDD:214738 19/80 (24%)
CG42526NP_001163401.1 MADF 8..85 CDD:214738 20/84 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.