DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9948 and si:ch211-207i20.3

DIOPT Version :9

Sequence 1:NP_001261492.1 Gene:CG9948 / 38757 FlyBaseID:FBgn0035721 Length:218 Species:Drosophila melanogaster
Sequence 2:XP_683419.5 Gene:si:ch211-207i20.3 / 555734 ZFINID:ZDB-GENE-141222-71 Length:263 Species:Danio rerio


Alignment Length:240 Identity:59/240 - (24%)
Similarity:92/240 - (38%) Gaps:54/240 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TSYKKNRPFDFK-----LIDLVEPNPVLYKRSGLSNYDAMKAKTDIWARIAEMMGCDVDFCLMRW 62
            |.|...|....|     |:.||..|..|:.::. |.|...|.|..:|..||:.||.||:....:|
Zfish    18 THYSVRRSMVVKMDAELLLFLVSENKELFDKNH-SEYKNTKRKEALWQGIADKMGVDVEEVKAKW 81

  Fly    63 NNLHYQFRKEFRRADTSGS----------TWPYLERLRFLAEIQPPSKVKTKPKTNKQEATIQTE 117
            .||...:.:: :|.:..||          .|.|:..:.||           .|.|..:...:.::
Zfish    82 KNLRDTYTRK-KRLEQDGSRSGRAAKKKKQWKYMRVMDFL-----------DPATEHRSGILDSK 134

  Fly   118 TPVQFLWDTFEDGDVPQQSSTFIIEEVIEEPSEQIIQEEIIYEEQEPAEIIS-PRSSFLQ-MDQI 180
                     .|| |.|.:.|.       .||:.......:...|...:.|:. .||..|: :::.
Zfish   135 ---------IED-DEPDEDSG-------AEPASTSTGTSVTSPEAMRSSIVKRRRSETLELLEKY 182

  Fly   181 LAQLKEPQRRRAERR---ITAFL--LKCQLRAL--SNQSVEDLSI 218
            ||......|.:.|::   :..||  |...||.|  |.||:..|.|
Zfish   183 LATKDAKDREKDEQQQDEVDLFLRSLAPALRRLPASKQSLVKLQI 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9948NP_001261492.1 MADF 14..95 CDD:214738 27/95 (28%)
si:ch211-207i20.3XP_683419.5 MADF 35..122 CDD:214738 26/99 (26%)
BESS 199..233 CDD:308542 11/29 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.