DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9948 and hng2

DIOPT Version :9

Sequence 1:NP_001261492.1 Gene:CG9948 / 38757 FlyBaseID:FBgn0035721 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_649837.1 Gene:hng2 / 41056 FlyBaseID:FBgn0037634 Length:254 Species:Drosophila melanogaster


Alignment Length:233 Identity:48/233 - (20%)
Similarity:90/233 - (38%) Gaps:62/233 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FKLIDLVEPNPVLYKRSGLSNYDAMKAKTDIWARIAEMMGCDVD------------FCLMRWNNL 65
            ::.||.|....::::||. .|:...:.:.:.|.:|...:..:.|            ..|.||.|.
  Fly    19 YEFIDAVHKRSIIWERSH-PNFHNRELRDEAWQQIGHELCSNFDDSSEPEKQEIVKTLLKRWKNT 82

  Fly    66 HYQFRKEFRRADTSG-----STWPYLERLRFLAEIQPPSK-----VKTKPKTNKQEATIQT---- 116
            ...:.: ..|...||     :::.|.:.|.||..::..|:     :|.:||...:...:.|    
  Fly    83 RDSYLR-VNRLRQSGEEVARASYIYEKELSFLLNVKAESEDDVESLKEQPKPQAKRKRVSTAAQR 146

  Fly   117 --ETPVQFLWDTFEDGDVPQQSSTFIIEEVIEEPS----------------EQIIQEEIIYEEQE 163
              :||.:      .:.|  |:|:   ||..|..|:                |.....||.|..|.
  Fly   147 SAKTPRK------RNSD--QESN---IEPAIRNPAIPSNINTVLGDLGCAKEDTATPEIAYIPQL 200

  Fly   164 PAE-IISPRSSFLQM--DQILAQLKEP--QRRRAERRI 196
            |:: ..|..:::|..  ||......:|  |:..|:|::
  Fly   201 PSDPPCSTNTAYLSADPDQAFFDTIKPHMQQMCADRKL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9948NP_001261492.1 MADF 14..95 CDD:214738 20/97 (21%)
hng2NP_649837.1 MADF_DNA_bdg 21..113 CDD:287510 18/93 (19%)
BESS 216..250 CDD:281011 6/23 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.