DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9948 and CG8765

DIOPT Version :9

Sequence 1:NP_001261492.1 Gene:CG9948 / 38757 FlyBaseID:FBgn0035721 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_649141.1 Gene:CG8765 / 40147 FlyBaseID:FBgn0036900 Length:690 Species:Drosophila melanogaster


Alignment Length:193 Identity:45/193 - (23%)
Similarity:75/193 - (38%) Gaps:30/193 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FDFKLIDLVEPNPVLYKRSGLSNYDAMKAKTDIWARIAEMMGCDVDFCLMRWNNLHYQFRKEFRR 75
            |:.:||.|::...::| ..|..||...|.|.::|..||..:...|..|.::|..|..|:.:|.:|
  Fly   315 FEKELITLIQQEDMIY-NYGNENYRNAKLKMEVWEEIARKLKKSVKQCRLKWKALRDQYAREHKR 378

  Fly    76 ADT-----SGSTWPYLERLRFLAEIQPPSKVKTKPKTNKQEATIQTETPVQFLWDTFEDGDVPQQ 135
            ..|     :.|.|.:...|.||   |...:.||....::....:....||:.|.|.......|  
  Fly   379 LRTLMHIDATSRWKHYNSLSFL---QKYIQQKTLESDSQLSMLLPKNDPVRELEDHMTQSHSP-- 438

  Fly   136 SSTFIIEEVIEEPSEQIIQEEIIYEEQ----EPAEIISPRSSFLQMDQILAQLKEPQRRRAER 194
                        |::||..|......|    ....:..|..:..|..|   |.:|.|.::.::
  Fly   439 ------------PTQQITLESSSSNSQLNLPTLPHLTGPHKAEQQQQQ---QQQEEQHQQQQQ 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9948NP_001261492.1 MADF 14..95 CDD:214738 25/85 (29%)
CG8765NP_649141.1 MADF 42..123 CDD:214738
MADF 318..405 CDD:214738 26/90 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.