DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9948 and CG3919

DIOPT Version :9

Sequence 1:NP_001261492.1 Gene:CG9948 / 38757 FlyBaseID:FBgn0035721 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001261840.1 Gene:CG3919 / 39582 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster


Alignment Length:174 Identity:44/174 - (25%)
Similarity:74/174 - (42%) Gaps:28/174 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KLIDLVEPNPVLYKRSGLSNYDAMKAKTDIWARIAEMMGCDVDFCLMRWNNLHYQFRKEFRRADT 78
            |:..||:.:|.||.|.. .||.......:.|..|:..|...|..|..||.|:...:.:..:.  .
  Fly    20 KICHLVKLHPCLYDRHD-DNYLRKSTVKNAWKEISNEMRNSVKSCKERWRNIRSSYARSIKL--H 81

  Fly    79 SGSTWPYL-ERLRFLAE-IQPPSKV-----KTKPKTNKQEATIQTETPVQFLWD-----TFEDGD 131
            .|:...|| ..|:||.: |.|...|     :::||..::......||||:.:.:     :|.:.:
  Fly    82 HGANTYYLNSELKFLQKHITPGVPVPLRGRRSRPKGQEEHDEGDPETPVEAILEMVHSPSFLNSE 146

  Fly   132 VPQQ-------SSTFI-IEEVIEEPSEQIIQEEIIYEEQEPAEI 167
            ..|.       |:|.: ..:...|||.  |.:   :|:..|||:
  Fly   147 HAQSRHSTDPASATDVEATQFNNEPSS--IMD---FEDTVPAEM 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9948NP_001261492.1 MADF 14..95 CDD:214738 23/82 (28%)
CG3919NP_001261840.1 MADF 20..100 CDD:214738 23/82 (28%)
BESS 226..260 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.