DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9948 and CG6683

DIOPT Version :9

Sequence 1:NP_001261492.1 Gene:CG9948 / 38757 FlyBaseID:FBgn0035721 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_648232.1 Gene:CG6683 / 38970 FlyBaseID:FBgn0035902 Length:197 Species:Drosophila melanogaster


Alignment Length:219 Identity:63/219 - (28%)
Similarity:108/219 - (49%) Gaps:36/219 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FDFKLIDLVEPNPVLYKRSGLSN--YDAMKAK-TDIWARIAEMMGCDVDFCLMRWNNLHYQFRKE 72
            ||.:||:||..||.||:|. |.|  |:|.|.: .:||:.||..:..:...|:.|||:|..:.|:|
  Fly     4 FDTRLIELVRANPKLYERE-LRNAPYEAHKKRHPEIWSSIATSLNSEASACVSRWNHLVAKQRRE 67

  Fly    73 F--RRADTSGSTWPYLERLRFLAEIQPPSKVKTKPKTNKQEATIQTETPVQFLWDTFEDGDVPQQ 135
            .  .:|..:||.|..|..|:||.....|  :..:...:...:|:::...|.      :|      
  Fly    68 LAKEKAGGTGSDWSLLPHLKFLQHHHHP--INHRNSGDLSRSTLKSSDEVN------DD------ 118

  Fly   136 SSTFIIEEVIEEPSEQIIQEEIIYEEQEPAEIISP------RSSFLQMDQILAQLKEPQRRRAER 194
                      |:|.::.:.|::......||...:|      ..:..:::.:|..|.|..|.:||:
  Fly   119 ----------EDPLQEAMDEQLAVAGAAPAPPTNPAHATPVAQAEKRIEALLEGLGEANRIKAEK 173

  Fly   195 RITAFLLKCQLRALSNQSVEDLSI 218
            ||.|:|.||.||||:::.::|:.|
  Fly   174 RILAYLCKCNLRALNDEQIDDIVI 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9948NP_001261492.1 MADF 14..95 CDD:214738 33/85 (39%)
CG6683NP_648232.1 MADF 7..94 CDD:214738 33/87 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453311
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009996
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.