DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9948 and Coop

DIOPT Version :9

Sequence 1:NP_001261492.1 Gene:CG9948 / 38757 FlyBaseID:FBgn0035721 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001260776.1 Gene:Coop / 35677 FlyBaseID:FBgn0263240 Length:358 Species:Drosophila melanogaster


Alignment Length:209 Identity:45/209 - (21%)
Similarity:81/209 - (38%) Gaps:39/209 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KLIDLVEPNPVLYKRSGLSNYDAMKAK--TDIWARIAEMMGCDVDFCLMRWNNLHYQFRKEFRRA 76
            :||..|...|:|:.|   :|.:..|..  |.:|..:.:.:....|.|.::|.:|...|||.:.|.
  Fly    42 RLIAAVSRRPMLWLR---NNANGQKRSDITPVWFEVGQDVNLPADICRIKWGHLRDNFRKVYIRN 103

  Fly    77 DTSG---STWPYLERLRFLAEI-------QPPSKVKTKPKTNKQE-------------ATIQTET 118
            :.|.   |:|.:...:||:...       |..|..|..|..:..|             ..:.|| 
  Fly   104 NLSNETPSSWRFYNDMRFMEPAVHENIMRQTRSSSKKHPPGHWTENNNVLGPDKYDSMPIVATE- 167

  Fly   119 PVQFLWDTFEDGDVPQQS----STFIIEEVIEEPSEQIIQEEIIYEEQEPAEIISPRSSFLQMDQ 179
            |:..|..:: |.::.|.|    |:|..:...:.|..:..:.|....|::..:     ......|.
  Fly   168 PICELSHSY-DSELHQPSFSDISSFFEDRDCQPPENKRFKSEPSQREEDEED-----DDDFDEDA 226

  Fly   180 ILAQLKEPQRRRAE 193
            ....|:|.:..||:
  Fly   227 ASENLEEERGNRAD 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9948NP_001261492.1 MADF 14..95 CDD:214738 23/85 (27%)
CoopNP_001260776.1 MADF 42..124 CDD:214738 23/84 (27%)
BESS 320..353 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009996
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.