DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9948 and CG8119

DIOPT Version :9

Sequence 1:NP_001261492.1 Gene:CG9948 / 38757 FlyBaseID:FBgn0035721 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_573050.1 Gene:CG8119 / 32500 FlyBaseID:FBgn0030664 Length:244 Species:Drosophila melanogaster


Alignment Length:209 Identity:44/209 - (21%)
Similarity:84/209 - (40%) Gaps:53/209 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 WARIAEMMGCDVDFCLMRWNNLHYQFRKEFRRADTSGSTWPYLERLRFLAEIQPPSKVKT----K 104
            |..::..:|..||.|..||.:|...:|.:..:.  :..:||:.:::.|:.::.||.|.||    :
  Fly    46 WLDVSNAVGLGVDECKRRWKSLRNNYRTKIHQG--NAWSWPHSKQMEFVRDVFPPHKPKTPARCR 108

  Fly   105 PKTNKQEATIQTETPVQFL-----WDTFEDGDVPQQSSTFIIEE----VIEEPSEQI-IQEEI-- 157
            .:..|.:..:.   |.|:|     :..|:.|.:     .|..||    |.:||:..: :.||:  
  Fly   109 VQVKKSKLILH---PQQYLQSVASYSAFKKGGI-----EFEAEERLFLVTDEPAFDLDVDEEVTR 165

  Fly   158 -------------------IYEEQEPAEII-----SPRSSFLQMDQILAQLKEPQRRRAE---RR 195
                               |:....|:.:.     |.|...|.|..:|..|.:..:.|..   ||
  Fly   166 LLGTDQWLWQTNLDFILLPIFRAPPPSAMAKISNESNRHFLLSMVPMLRSLSDRSKERFRSWTRR 230

  Fly   196 ITAFLLKCQLRALS 209
            :...:|..:.:.|:
  Fly   231 VLREMLIAEKKLLT 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9948NP_001261492.1 MADF 14..95 CDD:214738 12/50 (24%)
CG8119NP_573050.1 MADF 17..97 CDD:214738 12/52 (23%)
BESS 201..234 CDD:281011 9/32 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.