DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9948 and CG4404

DIOPT Version :10

Sequence 1:NP_648063.1 Gene:CG9948 / 38757 FlyBaseID:FBgn0035721 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_572838.2 Gene:CG4404 / 32241 FlyBaseID:FBgn0030432 Length:308 Species:Drosophila melanogaster


Alignment Length:225 Identity:51/225 - (22%)
Similarity:86/225 - (38%) Gaps:42/225 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KKNRP-FDFKLIDLVEPNPVL--YKRSGLSNYDAMKAKTDI---WARIAEMMGCDVDFCLMRWNN 64
            :|:.| |:.:.:..||..|.|  |...|.|.      |.|:   |.::|..:...|..|..||..
  Fly     8 RKDDPVFNVRFVQFVENQPCLWNYTHPGYSK------KEDVQRAWQQVANDIKDTVRNCRERWRT 66

  Fly    65 LHYQFRKEFRRADTS---GSTWPYLER-LRFLAEI--------QPPSKVKTKPKTNKQEATIQTE 117
            :...|.:..:.|.|.   |....||.: |:||...        |.|..|..||   .|.||.|.|
  Fly    67 IRSSFLRSLKLARTQTGRGKRKYYLSKYLQFLVPFTKSRSCHKQLPGMVLRKP---GQAATAQQE 128

  Fly   118 TPVQFLWD--TFEDGDVPQQSSTFIIEEVIEEPSEQIIQEEIIYEEQEPAEIISPRSSFLQMDQI 180
            ..|....:  ...||::|       ::..:.|...:..||:   :.::|...:..|...::::..
  Fly   129 DEVVAAEEEAKVSDGEMP-------LDVQVSEEEHRRNQEQ---DREQPTACLPLRLHSIKVEHD 183

  Fly   181 LAQLKEPQRRRAERRITAFLLKCQLRALSN 210
            .:...:...|...::   .|:.....||.|
  Fly   184 SSNANQQLERMVSQQ---SLVSVPAAALGN 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9948NP_648063.1 MADF 14..95 CDD:214738 24/89 (27%)
CG4404NP_572838.2 MADF 17..103 CDD:214738 24/91 (26%)
BESS 267..301 CDD:460758
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.