DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9948 and madf-3

DIOPT Version :9

Sequence 1:NP_001261492.1 Gene:CG9948 / 38757 FlyBaseID:FBgn0035721 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_494766.1 Gene:madf-3 / 186755 WormBaseID:WBGene00019218 Length:312 Species:Caenorhabditis elegans


Alignment Length:231 Identity:55/231 - (23%)
Similarity:89/231 - (38%) Gaps:63/231 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FDFKLIDLVEPNPVLYKRSGLSNYDAMKAKTDIWARIAEMMGCDVDFCLM--RWNNLHYQFRKEF 73
            |:.:||:.|..:..|:..:. ..|...:.|..:|.|:..::|.|.|..::  ||..|..::.||.
 Worm     6 FNLRLIEAVRHSRCLFDNTD-RQYRNTEYKNRVWQRLVTVLGFDGDPRMLSARWKQLRDKYGKEK 69

  Fly    74 RRA--DTSGSTWPYLERLRFL-------AEIQPPSKVKT-------KPKTNKQEATIQTETPVQF 122
            |:.  ....|:|.|.:.|.||       |||.|..|..|       :|...|.........|.  
 Worm    70 RKQKYGNEKSSWQYFKHLHFLDPHMTDRAEISPSRKEPTGVHEKIAEPCFGKNLILEVRRHPC-- 132

  Fly   123 LWDT----FEDGDVPQQSSTFIIEEVIEEPSEQIIQEEIIYEEQEPAEIISPRSSFLQMDQILAQ 183
            |:|.    :..||...|:...||:::                 :.|..:.|          |..|
 Worm   133 LYDVRDPKYRHGDCRTQAWGMIIDKL-----------------RYPGTVPS----------IYKQ 170

  Fly   184 LKEPQRR--RAERRITAFLLKCQLRALSNQSVEDLS 217
            .|:.:.|  |.:||         ||.|.:.:|:|:|
 Worm   171 WKKHRDRYVREKRR---------LRNLGDPNVQDVS 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9948NP_001261492.1 MADF 14..95 CDD:214738 24/91 (26%)
madf-3NP_494766.1 MADF 9..94 CDD:214738 23/85 (27%)
MADF 122..212 CDD:214738 23/114 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.