DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10077 and Ddx41

DIOPT Version :10

Sequence 1:NP_648062.2 Gene:CG10077 / 38756 FlyBaseID:FBgn0035720 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_598820.2 Gene:Ddx41 / 72935 MGIID:1920185 Length:622 Species:Mus musculus


Alignment Length:171 Identity:34/171 - (19%)
Similarity:64/171 - (37%) Gaps:51/171 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GDGEFQQNSSKVKIFDRDLKRIHRD----------RAAWLSR--QKNDSFVDAVADNLLD----- 89
            |.||    |.|..|. :.:|.||.|          ||...|.  |...:.:.|:::..:|     
Mouse    32 GAGE----SGKSTIV-KQMKIIHEDGYSEDECKQYRAVVYSNTIQSIMAIIKAMSNLKIDYGESA 91

  Fly    90 RLEDCKKSFPTAFC------LGGSLGAVKRLLRGRGGIEKLIMMDTSYDMIKSCRDAQDDSLDNS 148
            |::|.::.|..:..      |...|..|.|.|....|::........|.:        :||    
Mouse    92 RVDDARQLFALSAAAEEQGILTDDLANVIRRLWADSGVQGCFSRSREYQL--------NDS---- 144

  Fly   149 IETSYFVGD------EEFLPVKESSVDLIISSLGL---HWT 180
              .:|::.|      .:::|.::..:...:.:.|:   |:|
Mouse   145 --AAYYLNDLDRIARSDYIPTQQDVLRTRVKTTGIVETHFT 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10077NP_648062.2 DEAD-like_helicase_N 49..544 CDD:475120 31/164 (19%)
Ddx41NP_598820.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39 4/10 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..84 6/32 (19%)
Q motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00552 181..209 2/3 (67%)
DEADc_DDX41 192..397 CDD:350709
DEAD box. /evidence=ECO:0000255|PROSITE-ProRule:PRU00541 344..347
SF2_C_DEAD 408..536 CDD:350174
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.