DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10077 and Ddx43

DIOPT Version :9

Sequence 1:NP_001261491.1 Gene:CG10077 / 38756 FlyBaseID:FBgn0035720 Length:818 Species:Drosophila melanogaster
Sequence 2:XP_003750593.1 Gene:Ddx43 / 682138 RGDID:1586947 Length:646 Species:Rattus norvegicus


Alignment Length:467 Identity:190/467 - (40%)
Similarity:288/467 - (61%) Gaps:33/467 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 PKIVWSEV-------------NLTPFRKNFYKPCDSVLARTVGET-------ETF-LTSNEITIK 148
            |.|.|.::             :|.|.:||||  .:|....::.:.       |.| :|.:::. .
  Rat   167 PLIDWDQIREDALKWEKKKWADLPPIKKNFY--IESATTSSMSQVQIDNWRKENFNITCDDLK-D 228

  Fly   149 GDQ--VPTPSIEFEEG--GFPDYVMNEIRKQGFAKPTAIQAQGWPIAMSGRDLVGVAQTGSGKTL 209
            |::  :|.|..:||:.  .:|: ||..|::.||.|||.||:|.|||.:.|.||:||||||:||||
  Rat   229 GEKRPIPNPICKFEDAFHSYPE-VMENIKRAGFQKPTPIQSQAWPIVLQGIDLIGVAQTGTGKTL 292

  Fly   210 AYVLPAVVHINNQP-RLERGDGPIALVLAPTRELAQQIQQVAIEFGSNTHVRNTCIFGGAPKGQQ 273
            :|::|..:|:::|| ..|:.:||..|||.||||||.|::....:: |...:::.|::||..:..|
  Rat   293 SYLMPGFIHLDSQPLAREQRNGPGMLVLTPTRELALQVEAECSKY-SYGDLKSVCVYGGGDRDGQ 356

  Fly   274 ARDLERGVEIVIATPGRLIDFLERGTTSLKRCTYLVLDEADRMLDMGFEPQIRKIMQQIRPDRQV 338
            .:|:.:||:|:|||||||.|.......:||..|||||||||:||||||||||.||:..:|||||.
  Rat   357 IQDVSKGVDIIIATPGRLNDLQMNNFVNLKSVTYLVLDEADKMLDMGFEPQIMKILLDVRPDRQT 421

  Fly   339 LMWSATWPKEVRQLAEEFLNNYIQVNIGSLSLSANHNILQIVDVCDENEKLMKLIKLLTDISAEN 403
            :|.|||||..||:||:.:|...:.|.:|:|.|.|...:.|.:.:..|.||...:...|.::|.::
  Rat   422 IMTSATWPYAVRRLAQSYLKEPMIVYVGTLDLVAVSTVKQNIIITTEEEKRTHIQTFLENMSPKD 486

  Fly   404 ETKTIIFVETKKRVDEITRNISRQGWRACAIHGDKSQQERDFVLSSFRNGRHSILVATDVAARGL 468
              |.|:||..|...|.::.::..:.....::||::.|.:|:..|.:|:.|:..||:|||:|:|||
  Rat   487 --KVIVFVSRKAVADHLSSDLILRHISVESLHGNREQSDREKALENFKTGKVRILIATDLASRGL 549

  Fly   469 DVDDVKFVINYDYPSNSEDYVHRIGRTGRSNNTGTAYTLFTHSNANKANDLIQVLREANQTINPK 533
            ||.|:..|.|||:|.|.|:||||:|||||:..||.:.||.|.::...|.:||.:|..|||.|..:
  Rat   550 DVHDITHVYNYDFPRNIEEYVHRVGRTGRAGRTGMSITLITRNDWRIATELINILERANQNIPEE 614

  Fly   534 LMNMAMNGGYNK 545
            |:.||.....||
  Rat   615 LVLMAERYKANK 626

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10077NP_001261491.1 PTZ00110 49..544 CDD:240273 188/464 (41%)
DEADc 159..364 CDD:238167 104/207 (50%)
HELICc 375..507 CDD:238034 49/131 (37%)
Ddx43XP_003750593.1 KH-I 68..133 CDD:412160
PTZ00110 153..642 CDD:240273 190/467 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000439
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.