DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10077 and DDX55

DIOPT Version :9

Sequence 1:NP_001261491.1 Gene:CG10077 / 38756 FlyBaseID:FBgn0035720 Length:818 Species:Drosophila melanogaster
Sequence 2:XP_016875199.1 Gene:DDX55 / 57696 HGNCID:20085 Length:618 Species:Homo sapiens


Alignment Length:420 Identity:132/420 - (31%)
Similarity:211/420 - (50%) Gaps:57/420 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 VMNEIRKQGFAKPTAIQAQGWPIAMSGRDLVGVAQTGSGKTLAYVLPAV-VHINNQPRLERGD-G 230
            |:..:|:.||...|.:|:...|:.|..:|:...|.||||||||:|:|.: :.:..:.:|::.. |
Human    20 VLGALRELGFPYMTPVQSATIPLFMRNKDVAAEAVTGSGKTLAFVIPILEILLRREEKLKKSQVG 84

  Fly   231 PIALVLAPTRELAQQIQQVAIEFGSNTHVRNTCIF-GGAPKGQQARDLER----GVEIVIATPGR 290
              |:::.||||||.||.:|...|..:....:..:: ||...|:   |:||    |..|::|||||
Human    85 --AIIITPTRELAIQIDEVLSHFTKHFPEFSQILWIGGRNPGE---DVERFKQQGGNIIVATPGR 144

  Fly   291 LIDFLERGTTSL------KRCTYLVLDEADRMLDMGFEPQIRKIMQQIRPDRQVLMWSATWPKEV 349
            |.|...|....|      :....||||||||:||||||..|..|::.:...|:..::|||..:||
Human   145 LEDMFRRKAEGLDLASCVRSLDVLVLDEADRLLDMGFEASINTILEFLPKQRRTGLFSATQTQEV 209

  Fly   350 RQLAEEFLNNYIQVNI---GSLSLSANHNILQIVD---VCDENEKLMKLIKLLTDISAENETKTI 408
            ..|....|.|.::|::   |..:.||.....::.:   ||..:||..:|:..|.:   ..:.|.:
Human   210 ENLVRAGLRNPVRVSVKEKGVAASSAQKTPSRLENYYMVCKADEKFNQLVHFLRN---HKQEKHL 271

  Fly   409 IFVETK-----KRVDEITRNISR---------------QGWRACAIHGDKSQQERDFVLSSFRNG 453
            :|....     :.:.:..|..|.               :|.:...||| |.:.:|:.:...||..
Human   272 VFFRYSSGLCGRGIRDSARMCSTCACVEYYGKALEVLVKGVKIMCIHG-KMKYKRNKIFMEFRKL 335

  Fly   454 RHSILVATDVAARGLDVDDVKFVINYDYPSNSEDYVHRIGRTGRSNNTGTAYTLFTHSNANKAND 518
            :..|||.|||.|||:|:.:|.:|:.||.|||:..:|||.|||.|..:.|:|.........:..|.
Human   336 QSGILVCTDVMARGIDIPEVNWVLQYDPPSNASAFVHRCGRTARIGHGGSALVFLLPMEESYINF 400

  Fly   519 L-------IQVLREANQTIN--PKLMNMAM 539
            |       :|.::....|.:  |||.:||:
Human   401 LAINQKCPLQEMKPQRNTADLLPKLKSMAL 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10077NP_001261491.1 PTZ00110 49..544 CDD:240273 132/420 (31%)
DEADc 159..364 CDD:238167 75/208 (36%)
HELICc 375..507 CDD:238034 44/154 (29%)
DDX55XP_016875199.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0331
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.