DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10077 and eIF4A

DIOPT Version :9

Sequence 1:NP_001261491.1 Gene:CG10077 / 38756 FlyBaseID:FBgn0035720 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_001245907.1 Gene:eIF4A / 33835 FlyBaseID:FBgn0001942 Length:403 Species:Drosophila melanogaster


Alignment Length:410 Identity:142/410 - (34%)
Similarity:219/410 - (53%) Gaps:28/410 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 NEITIKG--DQVPTPSIE---------FEEGGFPDYVMNEIRKQGFAKPTAIQAQGWPIAMSGRD 196
            |||...|  ...|...||         |::....:.::..|...||.||:|||.:.....:.|||
  Fly     5 NEIPQDGPASMEPEGVIESTWHEVYDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRD 69

  Fly   197 LVGVAQTGSGKTLAYVLPAVVHINNQPRLERGDGPIALVLAPTRELAQQIQQVAIEFGSNTHVRN 261
            ::..||:|:|||..:.:..:..|:...|..:     ||:||||||||.|||:|.:..|....|.:
  Fly    70 VIAQAQSGTGKTATFSIAILQQIDTSIRECQ-----ALILAPTRELATQIQRVVMALGEYMKVHS 129

  Fly   262 TCIFGGAPKGQQARDLERGVEIVIATPGRLIDFLERGTTSLKRCTYLVLDEADRMLDMGFEPQIR 326
            ....||....:.||.||.|..:|:.||||:.|.:.|.....:.....||||||.||..||:.||:
  Fly   130 HACIGGTNVREDARILESGCHVVVGTPGRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQ 194

  Fly   327 KIMQQIRPDRQVLMWSATWPKEVRQLAEEFLNNYIQVNIGSLSLSANHNILQI-VDVCDENEKLM 390
            .:.:.:.||.||::.|||.|.:|.:::..|:.:.:.:.:....|:. ..|.|. |:|..||.||.
  Fly   195 DVFKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEELTL-EGIKQFYVNVKQENWKLG 258

  Fly   391 KLIKLLTDISAENETKTIIFVETKKRVDEITRNISRQGWRACAIHGDKSQQERDFVLSSFRNGRH 455
            .|..|...:|.   |:::||..|:::||::|:.:|...:...|:|||..|::|:.::..||:|..
  Fly   259 TLCDLYDTLSI---TQSVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSS 320

  Fly   456 SILVATDVAARGLDVDDVKFVINYDYPSNSEDYVHRIGRTGRSNNTGTAYTLFTHSNANKANDLI 520
            .:|:.||:.|||:||..|..|||||.|||.|:|:|||||.||....|.|....|       :|..
  Fly   321 RVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFIT-------DDDR 378

  Fly   521 QVLREANQTINPKLMNMAMN 540
            ::|::..|..:..:..|..|
  Fly   379 RILKDIEQFYHTTIEEMPAN 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10077NP_001261491.1 PTZ00110 49..544 CDD:240273 142/410 (35%)
DEADc 159..364 CDD:238167 72/204 (35%)
HELICc 375..507 CDD:238034 56/132 (42%)
eIF4ANP_001245907.1 PTZ00424 6..403 CDD:185609 141/409 (34%)
DEADc 32..232 CDD:238167 72/204 (35%)
Helicase_C 254..358 CDD:278689 44/106 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451422
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.