DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10077 and CG32344

DIOPT Version :9

Sequence 1:NP_001261491.1 Gene:CG10077 / 38756 FlyBaseID:FBgn0035720 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_612028.4 Gene:CG32344 / 326208 FlyBaseID:FBgn0052344 Length:827 Species:Drosophila melanogaster


Alignment Length:375 Identity:113/375 - (30%)
Similarity:198/375 - (52%) Gaps:10/375 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 DQVPTPSIEFEEGGFPDY-----VMNEIRKQGFAKPTAIQAQGWPIAMSGRDLVGVAQTGSGKTL 209
            |.:.:.|.:.:.|||...     ::..|.|:|:..||.||.:..|:.:.|||:|.:|:||||||.
  Fly    27 DILKSKSKKNKSGGFQSMGLGFELIKGITKRGYKVPTPIQRKTIPLILEGRDVVAMAKTGSGKTA 91

  Fly   210 AYVLPAVVHINNQPRLERGDGPIALVLAPTRELAQQIQQVAIEFGSNTHVRNTCIFGGAPKGQQA 274
            .:::|....:.   |.|...|..||:|:||||||.|..:...|.|....:::..:.||.....|.
  Fly    92 CFLIPLFEKLQ---RREPTKGARALILSPTRELAVQTYKFIKELGRFMELKSILVLGGDSMDSQF 153

  Fly   275 RDLERGVEIVIATPGRLIDFLERGTTSLKRCTYLVLDEADRMLDMGFEPQIRKIMQQIRPDRQVL 339
            ..:....::::|||||.:.........|....|:|.|||||:.:|||..|:.:.:.::...||.:
  Fly   154 SAIHTCPDVIVATPGRFLHLCVEMDLKLNSIEYVVFDEADRLFEMGFGEQLNETLHRLPSSRQTV 218

  Fly   340 MWSATWPKEVRQLAEEFLNNYIQVNIGSLSLSANHNILQIVDVCDENEKLMKLIKLLTDISAENE 404
            |:|||.||.:.:.|...||:.:.:.:...|...:...|:.: .|..:::...|:.||..: ...:
  Fly   219 MFSATLPKLLVEFARAGLNDPVLIRLDVESKLPDALALKFL-YCRPDDRYTALVVLLKYV-IPVQ 281

  Fly   405 TKTIIFVETKKRVDEITRNISRQGWRACAIHGDKSQQERDFVLSSFRNGRHSILVATDVAARGLD 469
            ::|::|..|:..|:.|:..::..|....:::.......|....:.|.|.:.|:|:.|||||||:|
  Fly   282 SQTVVFAGTQHHVELISYILTEAGISNASVYSSLDPAARKINTAKFVNKKVSVLIVTDVAARGID 346

  Fly   470 VDDVKFVINYDYPSNSEDYVHRIGRTGRSNNTGTAYTLFTHSNANKANDL 519
            :..:.||:|..:|...:.:|||:||..|:..|||||::.:..:.....||
  Fly   347 IPSLDFVVNLHFPGKPKLFVHRVGRCARAGRTGTAYSIVSTDDTAHLLDL 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10077NP_001261491.1 PTZ00110 49..544 CDD:240273 113/375 (30%)
DEADc 159..364 CDD:238167 69/209 (33%)
HELICc 375..507 CDD:238034 39/131 (30%)
CG32344NP_612028.4 DEADc 41..243 CDD:238167 67/204 (33%)
DEXDc 54..243 CDD:214692 66/191 (35%)
HELICc 263..384 CDD:238034 37/121 (31%)
DBP10CT 666..721 CDD:285373
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451407
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.