DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10077 and Ddx23

DIOPT Version :9

Sequence 1:NP_001261491.1 Gene:CG10077 / 38756 FlyBaseID:FBgn0035720 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_001100263.2 Gene:Ddx23 / 300208 RGDID:1308685 Length:819 Species:Rattus norvegicus


Alignment Length:459 Identity:180/459 - (39%)
Similarity:257/459 - (55%) Gaps:49/459 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 WSEVNLTPFRKNFYKPCDSVLARTVGETETFLTSNEITIKGDQVPTPSIEFEEGGFPDYVMNEIR 173
            ||:           |..|.:..|   :...|.....||.||.::|.|...:::...|.:::..|.
  Rat   356 WSQ-----------KKLDEMTDR---DWRIFREDYSITTKGGKIPNPIRSWKDSSLPPHILEVID 406

  Fly   174 KQGFAKPTAIQAQGWPIAMSGRDLVGVAQTGSGKTLAYVLPAVVHINNQPRLER----GDGPIAL 234
            |.|:.:||.||.|..||.:..||::|||:||||||.|:::|.:|.|...|:::|    ..||.|:
  Rat   407 KCGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKIDRIEESDQGPYAI 471

  Fly   235 VLAPTRELAQQIQQVAIEFGSNTHVRNTCIFGGAPKGQQARDLERGVEIVIATPGRLIDFLERGT 299
            :|||||||||||::..|:||....:|...:.||..:..|...|..|.||||||||||||.||...
  Rat   472 ILAPTRELAQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCEIVIATPGRLIDVLENRY 536

  Fly   300 TSLKRCTYLVLDEADRMLDMGFEPQIRKIMQQI-----RPD---------------------RQV 338
            ..|.||||:||||||||:||||||.::||::.:     :||                     ||.
  Rat   537 LVLSRCTYVVLDEADRMIDMGFEPDVQKILEHMPVSNQKPDTDEAEDPEKMLANFESGKHKYRQT 601

  Fly   339 LMWSATWPKEVRQLAEEFLNNYIQVNIGSLSLSANHNILQIVDVCDENEKLMKLIKLLTDISAEN 403
            :|::||.|..|.:||..:|.....|.|||.. ..:..:.|.|.:..|:||..||:.:|   ....
  Rat   602 VMFTATMPPAVERLARSYLRRPAVVYIGSAG-KPHERVEQKVFLMSESEKRKKLLAIL---EQGF 662

  Fly   404 ETKTIIFVETKKRVDEITRNISRQGWRACAIHGDKSQQERDFVLSSFRNGRHSILVATDVAARGL 468
            :...||||..||..|.:.:::.:.|:.||.:||.|.|::|:|.||:.:.|...||||||||.||:
  Rat   663 DPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGI 727

  Fly   469 DVDDVKFVINYDYPSNSEDYVHRIGRTGRSNNTGTAYTLFTHSNANKANDLIQVLREAN-QTINP 532
            |:.||..|:|||...|.|||:||||||||:..:|.|.|..|..::....:|.|.:.|:. .:..|
  Rat   728 DIQDVSMVVNYDMAKNIEDYIHRIGRTGRAGKSGVAITFLTKEDSAVFYELKQAILESPVSSCPP 792

  Fly   533 KLMN 536
            :|.|
  Rat   793 ELAN 796

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10077NP_001261491.1 PTZ00110 49..544 CDD:240273 180/459 (39%)
DEADc 159..364 CDD:238167 98/234 (42%)
HELICc 375..507 CDD:238034 58/131 (44%)
Ddx23NP_001100263.2 SF-CC1 79..>207 CDD:273721
DEADc_DDX23 401..627 CDD:350703 97/225 (43%)
SF2_C_DEAD 638..767 CDD:350174 59/131 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D183201at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.