DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10077 and Gpr149

DIOPT Version :9

Sequence 1:NP_001261491.1 Gene:CG10077 / 38756 FlyBaseID:FBgn0035720 Length:818 Species:Drosophila melanogaster
Sequence 2:NP_796320.2 Gene:Gpr149 / 229357 MGIID:2443628 Length:732 Species:Mus musculus


Alignment Length:209 Identity:37/209 - (17%)
Similarity:78/209 - (37%) Gaps:53/209 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   359 NYIQVNIG------SLSLSANHNILQIVDVCDENEKLMK------LIKLLTDISAENETKTIIFV 411
            |.|.|.|.      |.:|:..|.... .|: .|:::.||      .:|..:||   |..:|..|.
Mouse   451 NTITVEISTTPPLDSATLTGVHKCTN-TDI-PESKQAMKEEKGAFSVKTESDI---NYGETTSFE 510

  Fly   412 ETKKRVD-EITRNISRQGWRACAIHGDKSQQERD-----FVLSSFR--------NGRHSILVATD 462
            ..::|:. |..:......|..|....:::.::|.     ..:.:|:        .|:...|...:
Mouse   511 GPERRLSHEENQKPDLSDWEWCRSKSERTPRQRSGGGLAIPICAFQGTVSLQAPTGKTLSLSTYE 575

  Fly   463 VAARGLDVDDVKFVINYDYPSNSEDYVHRIGRTGRSNNTGTAYTLFTHSNA------------NK 515
            |:|.|..:.          |::.:..|:|....|...|:..:.:.|..::.            ::
Mouse   576 VSAEGQKIT----------PASKKIEVYRSKSVGHEPNSEESPSTFADTSVKIHLEVLEICDNDE 630

  Fly   516 ANDLIQVLREANQT 529
            |.|.:.::...:|:
Mouse   631 ALDTVSIISNISQS 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10077NP_001261491.1 PTZ00110 49..544 CDD:240273 37/209 (18%)
DEADc 159..364 CDD:238167 2/4 (50%)
HELICc 375..507 CDD:238034 26/151 (17%)
Gpr149NP_796320.2 7tm_1 56..>211 CDD:278431
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..302
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 501..526 6/27 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0331
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.