DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tow and 1700025G04Rik

DIOPT Version :9

Sequence 1:NP_001261489.1 Gene:tow / 38755 FlyBaseID:FBgn0035719 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_932107.1 Gene:1700025G04Rik / 69399 MGIID:1916649 Length:121 Species:Mus musculus


Alignment Length:124 Identity:37/124 - (29%)
Similarity:64/124 - (51%) Gaps:14/124 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCGQSKIHLYPRKSKSKANGKKGGHADSDAETDEDEGHIEDAEKAQQRDREKHDESEELSNKDI 65
            |||..:| |:...:::.:|   :.|.:..:.:...||..|:..|:.:.. :...:|.::::.:: 
Mouse     1 MGCASAK-HVATVQNEEEA---QRGKSYQNGDVFGDEYRIKPVEEVKYM-KNGAEEEQKIAARN- 59

  Fly    66 QESDEDVAVSLLRAKNLSLL--------QSQEISSSQQNFFRMLDKKIDEGPDYDSASE 116
            ||:.|..|.|..|.|....:        .:..||.|||.||||||:||::|.||.|..|
Mouse    60 QENLEKSASSNTRLKTNKEIPGLVHQPRANMHISESQQEFFRMLDEKIEKGRDYCSEEE 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
towNP_001261489.1 DUF4612 2..116 CDD:292032 35/121 (29%)
1700025G04RikNP_932107.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28 7/30 (23%)
DUF4612 2..118 CDD:405968 35/121 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 60..81 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848331
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.