DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tow and zgc:55943

DIOPT Version :9

Sequence 1:NP_001261489.1 Gene:tow / 38755 FlyBaseID:FBgn0035719 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001278285.1 Gene:zgc:55943 / 406337 ZFINID:ZDB-GENE-040426-2013 Length:113 Species:Danio rerio


Alignment Length:123 Identity:37/123 - (30%)
Similarity:58/123 - (47%) Gaps:20/123 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCGQSKIHLYPRKSKSKANGKKG-GHADSDAETDEDEGHIEDAEKAQQRDREKHDESEELSNKD 64
            |||..:|      :..|..:.::| |.|.|:.:...||..::..||.    :..|.|.|..:.::
Zfish     1 MGCTSAK------QLSSVPSDEEGRGKAYSNGDAFSDEYKLKGVEKV----KYMHGEEEHTNTRN 55

  Fly    65 IQESDEDVAVSLLRAK------NLSLLQSQEISSSQQNFFRMLDKKIDEGPDYDSASE 116
            .:..::...:...|.|      |...:.|.|   |||.||||||:||::|.||.|..|
Zfish    56 QENLEKSTLLHKGRHKDATGNGNKISIHSSE---SQQEFFRMLDEKIEKGRDYCSEDE 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
towNP_001261489.1 DUF4612 2..116 CDD:292032 35/120 (29%)
zgc:55943NP_001278285.1 DUF4612 2..110 CDD:317755 35/120 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593761
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.