DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tow and RGD1309104

DIOPT Version :9

Sequence 1:NP_001261489.1 Gene:tow / 38755 FlyBaseID:FBgn0035719 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001099429.1 Gene:RGD1309104 / 289084 RGDID:1309104 Length:121 Species:Rattus norvegicus


Alignment Length:131 Identity:41/131 - (31%)
Similarity:61/131 - (46%) Gaps:28/131 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCGQSKIHL-------YPRKSKSKANGKKGGHADSDAETDEDEGHIEDAEKAQQRDREKHDESE 58
            |||..:| |:       ..:|.||..||...|          ||..|:..|:.:.. :...:|.:
  Rat     1 MGCASAK-HVATVQNEEEAQKGKSYQNGDVFG----------DEYRIKPVEEVKYM-KNGAEEEQ 53

  Fly    59 ELSNKDIQESDEDVAVSLLRAKNLSLL--------QSQEISSSQQNFFRMLDKKIDEGPDYDSAS 115
            :::.:: ||:.|..|.|..|.|....:        .:..||.|||.||||||:||::|.||.|..
  Rat    54 KIAARN-QENLEKSASSNTRLKTNKEIPGFVHQPRANMHISESQQEFFRMLDEKIEKGRDYCSEE 117

  Fly   116 E 116
            |
  Rat   118 E 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
towNP_001261489.1 DUF4612 2..116 CDD:292032 39/128 (30%)
RGD1309104NP_001099429.1 DUF4612 2..118 CDD:405968 39/128 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351945
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14974
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.