DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14820 and AT5G42320

DIOPT Version :9

Sequence 1:NP_648060.1 Gene:CG14820 / 38754 FlyBaseID:FBgn0035718 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001332683.1 Gene:AT5G42320 / 834237 AraportID:AT5G42320 Length:430 Species:Arabidopsis thaliana


Alignment Length:288 Identity:64/288 - (22%)
Similarity:112/288 - (38%) Gaps:68/288 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 ITSMEWTQFHTLEEIYAWLDVIEDRYPDIVTPFTIGNSYEG--------RPIRGVKISYKEGNPA 163
            :|.:.|..:|:.:::...:..:..|:||.::...|.:..:|        ...||.|.|....|..
plant    37 VTPINWDLYHSSDDLMEQIHSLVHRHPDKLSIELIKSGNKGYNAEVNVVTYCRGGKESDDRSNFR 101

  Fly   164 VFIESNIHAREWITS----ATITYFIDELLVP-RNPAVRDIAQNVDWYII---PVLNTDGFAYSH 220
            :.:....|.||.|||    ..::...:|..:| :|..:  :...:|..:|   |:.|.:|     
plant   102 ILLTFGQHGRELITSELAFRILSILSEEQFLPNKNGGI--LKNTLDKLVIKMVPIENPNG----- 159

  Fly   221 EVERLWRKSRLPSDPTGECI------GTDLNRNFDYLWMLTGAESDPCSQLYAGPSPESDPEISQ 279
                   :.|:.|   |:..      |.|||||:...|.....:.|| |:...|.:|.|:||...
plant   160 -------RKRVES---GDLCERRNGRGVDLNRNWGVDWGKKEKDYDP-SEENPGTAPFSEPETQI 213

  Fly   280 LTAYINNSIPEGTIKIYISLHSYGQYVLSPWGHTALEFPEHYP-QMMH----------------V 327
            :.....:..|.    |:|::||..:.:..|:.|..:. ||..| |.|.                :
plant   214 MRKLAISFDPH----IWINVHSGMEALFMPYDHKNIT-PEGLPSQKMRTLLEKLNKFHCHDRCMI 273

  Fly   328 AKGFSDALYRRYGTVFTYGSSATTLYEV 355
            ..|.....|..:||...|      :|:|
plant   274 GSGGGSVGYLAHGTATDY------IYDV 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14820NP_648060.1 Propep_M14 31..100 CDD:280416
M14_CP_A-B_like 115..410 CDD:199844 62/280 (22%)
AT5G42320NP_001332683.1 M14-CPA-like 100..321 CDD:349446 51/225 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D524270at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.