DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14820 and AGBL2

DIOPT Version :9

Sequence 1:NP_648060.1 Gene:CG14820 / 38754 FlyBaseID:FBgn0035718 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_079059.2 Gene:AGBL2 / 79841 HGNCID:26296 Length:902 Species:Homo sapiens


Alignment Length:436 Identity:90/436 - (20%)
Similarity:147/436 - (33%) Gaps:141/436 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VRIDDLEQFKLLHTQERSLKLSSWREARHLGESSDIMLPPEYQKTFESLL-TKHNFTYNLK---- 90
            ||:|..|....|.|...:.|.:.|...|......|    ..|:.|..:|| .|..:|..:|    
Human   281 VRVDTYEYELTLRTDLYTNKHTQWFYFRVQNTRKD----ATYRFTIVNLLKPKSLYTVGMKPLLY 341

  Fly    91 --IDNVQTHI-----------------DAQRPKQRITSMEWT-QF--------------HTLEEI 121
              :|....:|                 |.|:|...:|   || ||              :|..::
Human   342 SQLDANTRNIGWRREGNEIKYYKNNTDDGQQPFYCLT---WTIQFPYDQDTCFFAHFYPYTYTDL 403

  Fly   122 YAWLDVIEDRYPDIVTPF----TIGNSYEGRPIRGVKISYKEGNP-------AVFIESNIHAREW 175
            ..:|..:.:.  .|.:.|    |:..|..|..:..:.|:.....|       ||.:.:.:|..|.
Human   404 QCYLLSVANN--PIQSQFCKLQTLCRSLAGNTVYLLTITNPSQTPQEAAAKKAVVLSARVHPGES 466

  Fly   176 ITSATITYFIDELL--VPRNPAVRDIAQNVDWYIIPVLNTDGFAYSHEVERLWRKSRLPSDPTGE 238
            ..|..:..|:|.:|  .|....:|||   ..:.::|:||.||....:     :|.|         
Human   467 NGSWVMKGFLDFILSNSPDAQLLRDI---FVFKVLPMLNPDGVIVGN-----YRCS--------- 514

  Fly   239 CIGTDLNRNFDYLWMLTGAESDPCSQLYAGPSPESDPEISQLTAYINNSIPEGTIKIYISLHS-- 301
            ..|.||||::..:.    .||.||              |......|...:.|..:.:|...|.  
Human   515 LAGRDLNRHYKTIL----KESFPC--------------IWYTRNMIKRLLEEREVLLYCDFHGHS 561

  Fly   302 -------YG------QYVLSPWGHTALEFP----EHYP----------QMMHVAKGFSDALYRRY 339
                   ||      :|    |.|..: ||    ::.|          ::....:|....:..|.
Human   562 RKNNIFLYGCNNNNRKY----WLHERV-FPLMLCKNAPDKFSFHSCNFKVQKCKEGTGRVVMWRM 621

  Fly   340 GTVFTYGSSATTLYEVSGSGKEWAYAVKNIKIHYTIELRDKGELGF 385
            |.:.:|...:|......|:.::         .|:|||  |...||:
Human   622 GILNSYTMESTFGGSTLGNKRD---------THFTIE--DLKSLGY 656

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14820NP_648060.1 Propep_M14 31..100 CDD:280416 19/92 (21%)
M14_CP_A-B_like 115..410 CDD:199844 64/327 (20%)
AGBL2NP_079059.2 GVQW 105..>120 CDD:290611
M14_AGBL2-3_like 407..666 CDD:133117 62/303 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 746..770
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 796..879
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.