DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14820 and Agbl3

DIOPT Version :9

Sequence 1:NP_648060.1 Gene:CG14820 / 38754 FlyBaseID:FBgn0035718 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001276585.1 Gene:Agbl3 / 76223 MGIID:1923473 Length:1006 Species:Mus musculus


Alignment Length:371 Identity:70/371 - (18%)
Similarity:108/371 - (29%) Gaps:162/371 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 EYQKTFE-SLLT-KHNFTYNLKIDNVQ-------THIDAQRPK---------------------- 104
            ||:.|.. .|.| ||...|..::.|.|       |.::..:|.                      
Mouse   195 EYELTVRPDLFTNKHTQWYYFQVTNTQAEIVYRFTIVNFTKPASLYNRGMKPLFYSEKEAKTHNI 259

  Fly   105 --QRI------------------TSMEWT-QF-HTLEEIYAWLDVIEDRYPDIVTPFTIGNSYE- 146
              |||                  .|:.|| || |:.:..|     ....|     |:|..|..| 
Mouse   260 GWQRIGDQIKYYKNNLGQDGRHFFSLTWTFQFPHSQDTCY-----FAHCY-----PYTYSNLQEY 314

  Fly   147 -----GRPIRG-------------------------VKISYKEGNPAVFIESNIHAREWITSATI 181
                 ..|:|.                         :|.|..: ..||.:.:.:|..|..:|..:
Mouse   315 LSGINSDPVRSKFCKIRVLCHTLARNMVYVLTITTPLKTSDSK-RKAVILTARVHPGETNSSWIM 378

  Fly   182 TYFIDELLVPRNPAVRDIAQNVDWYIIPVLNTDGFAYSHEVERLWRKSRLPSDPTGECIGTDLNR 246
            ..|:|.:|...:.| |.:.....:.::|:||.||....:     :|.|         ..|.||||
Mouse   379 KGFLDYILGDSSDA-RLLRDTFIFKVVPMLNPDGVIVGN-----YRCS---------LAGRDLNR 428

  Fly   247 NFDYLWMLTGAESDPCSQLYAGPSPESDPEISQLTAYINNSIPEGTIKIYISLHSYGQYVLSPWG 311
            |                  |.....||.|.:......||..:.:..:.:|..||          |
Mouse   429 N------------------YTSLLKESFPSVWYTRNMINRLMEKREVILYCDLH----------G 465

  Fly   312 HTALEFPEHYPQMMHVAKGFSDALYRRYGTVFTYGSSATTLYEVSG 357
            |:                        |...:|.||...::..:..|
Mouse   466 HS------------------------RKQNIFMYGCDGSSRSKTKG 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14820NP_648060.1 Propep_M14 31..100 CDD:280416 11/37 (30%)
M14_CP_A-B_like 115..410 CDD:199844 51/275 (19%)
Agbl3NP_001276585.1 M14_AGBL2-3_like 315..576 CDD:133117 43/241 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 790..810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.