DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14820 and Cpo

DIOPT Version :9

Sequence 1:NP_648060.1 Gene:CG14820 / 38754 FlyBaseID:FBgn0035718 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_038940238.1 Gene:Cpo / 689717 RGDID:1588771 Length:325 Species:Rattus norvegicus


Alignment Length:372 Identity:88/372 - (23%)
Similarity:151/372 - (40%) Gaps:99/372 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 MLPPEYQKTFESLLTKHNFTYNLKIDNVQTHIDAQRPKQRITSMEWTQFHTL-EEIYAWLDVIED 130
            |..|::::.|.|                        |::.:.:..:.::|.. ..||.|:..:.:
  Rat     1 MADPQHRQEFVS------------------------PQRSLETYSYDRYHPWGRGIYQWMRQVSE 41

  Fly   131 RYPDIVTPFTIGNSYEGRPIRGVK----ISYKEGN--PAVFIESNIHAREWITSATITYFIDE-- 187
            :|.:::|...:..:||..|:..:|    ||....|  ..::|:..|||..||..|...:|:.|  
  Rat    42 KYAEVLTQHFLRMTYETWPMHYLKESAEISLTSSNSKKTIWIDCGIHASRWIAPAFCQWFLREGS 106

  Fly   188 ---LLVPRNPAVRDIAQ--NVDWYIIP---------------------------------VLNTD 214
               .|:..|.|:..::.  :.:.|..|                                 |||.|
  Rat   107 VFTCLLMLNHAIEYLSTLGSSETYFFPVNWNGIQLAPLQILQNDKDSARIGRLLKELDFXVLNAD 171

  Fly   215 GFAYSHEVERLWRKS-RLPSDPTGEC--IGTDLNRNFDYLWMLTGAESDPCSQL-YAGPSPESDP 275
            |..|:      |..: .||......|  |||.:|                |..: :.|..|..:|
  Rat   172 GXIYT------WTTAWTLPVGQGYLCLHIGTPIN----------------CQDVTFCGIEPMLEP 214

  Fly   276 EISQLTAYINNSIPEGTIKIYISLHSYGQYVLSPWGHTALEFPEHYPQMMHVAKGFSDALYRRYG 340
            |::...| :..:..:..|..::.:.||||.:|:|:|||..: |.:|.:::.|.:..:.||..::|
  Rat   215 ELTPSQA-LQKARGKKDILCFLIMGSYGQLILTPYGHTKNK-PHNYEELIQVGQKAARALKAKHG 277

  Fly   341 TVFTYGSSATTLYEVSGSGKEWAYAVKNIKIHYTIELRDKGELGFVL 387
            |.:..||.|..||.:|||.|:|...:......||.||.|.|..||.|
  Rat   278 TNYRVGSGADILYMLSGSSKDWNGGIGIPLFSYTFELVDNGTHGFAL 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14820NP_648060.1 Propep_M14 31..100 CDD:280416 4/32 (13%)
M14_CP_A-B_like 115..410 CDD:199844 83/324 (26%)
CpoXP_038940238.1 Peptidase_M14_like 22..324 CDD:416253 82/325 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.