DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14820 and CG8564

DIOPT Version :9

Sequence 1:NP_648060.1 Gene:CG14820 / 38754 FlyBaseID:FBgn0035718 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster


Alignment Length:388 Identity:102/388 - (26%)
Similarity:169/388 - (43%) Gaps:58/388 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 QKTFESLLTKHNFTYNLKIDNV--QTHIDAQRPKQRITSMEWTQFHT---LEEIYAWLDVIEDRY 132
            |.|..:||.......|:|....  ::..||....:|:........||   .:::..:|..:..||
  Fly     7 QGTRLALLVVERLHLNIKCQTAKDRSRTDATTALRRLVIPRPDILHTYLDYKQVNQYLQYLAQRY 71

  Fly   133 PDIVTPFTIGNSYEGRPIRGVKISY------------KEGNP----------------------- 162
            ...|....:|:::|.|.||.::|::            :|.:|                       
  Fly    72 AHFVHVHILGHTHEKREIRALEINWMNSENVELSPQMREHSPRLFDIGPNGRFTVPVIHVGEHCR 136

  Fly   163 -AVFIESNIHAREWITSATITYFIDELLVPRNPAVRDIAQNVDWYIIPVLNTDGFAYSHEVERLW 226
             .||||:..||||||:.:|....|.: |..|.....::.:.:.:.|:|::|.||:.||......|
  Fly   137 KTVFIEAGTHAREWISVSTALNCIYQ-LTERYTRNIEVLRKLRFIIVPLVNPDGYEYSRTKNPKW 200

  Fly   227 RKSRLPSDPTGECIGTDLNRNFDYLWMLTGAESDPCS---QLYAGPSPESDPEISQLTAYINNSI 288
            ||:|.| ..:.:.:|||.|||:|..|     .|.|..   ..|.|.||.|:||...:...::.. 
  Fly   201 RKNRRP-HKSAKFVGTDCNRNYDIFW-----NSGPSKINRNTYKGESPFSEPETRAMRCILDRM- 258

  Fly   289 PEGTIKIYISLHSYGQYVLSPWGHTALEFPEHYPQMMHVAKGFSDALYRRYGTVFTYGS-SATTL 352
             ...:..::|||||||.::.|||: ..:.|.::.::..:|.....|:....|..:..|| |..|.
  Fly   259 -SSNLLFFLSLHSYGQSIMYPWGY-CRDNPIYWRELSSLANSGKSAIKSYNGREYRTGSISCLTK 321

  Fly   353 YEVSGSGKEWAYAVKNIKIHYTIELRDKGELGFVLPPEDIIPVAREVTEGFVGMIAAAREIDI 415
            ..::||..::.|.|..:.:...:||..: ||||..|.|.|..:..|...|...|  ..|..|:
  Fly   322 RTIAGSVVDYVYGVLKVPMALVMELPSR-ELGFQPPVEMISQIGHESWYGIREM--CKRSFDL 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14820NP_648060.1 Propep_M14 31..100 CDD:280416 6/28 (21%)
M14_CP_A-B_like 115..410 CDD:199844 91/337 (27%)
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 89/335 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.