DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14820 and CG32379

DIOPT Version :9

Sequence 1:NP_648060.1 Gene:CG14820 / 38754 FlyBaseID:FBgn0035718 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_729252.2 Gene:CG32379 / 326211 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster


Alignment Length:349 Identity:126/349 - (36%)
Similarity:192/349 - (55%) Gaps:26/349 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LTKHNFTYNLKIDNVQTHIDAQRPK--QRITSMEW------TQFHTLEEIYAWLDVIEDRYPDIV 136
            :..::..|.:.|:::...:.|||.:  ::...::|      :.|:|..||..:||.:.:|:|..|
  Fly     1 MRNYHLEYKVLIEDLAPLVHAQRAENLRKKLLIQWPHIDVLSAFYTHSEINDYLDSLLERFPKRV 65

  Fly   137 TPFTIGNSYEGRPIRGVKISYKEG---NPAVFIESNIHAREWITSATITYFIDELLVPRNPAVRD 198
            .....|.|||.||::.:.|:..:|   .|.:.|:..:||||||:.:...|.|.:|| ......::
  Fly    66 QVKQFGWSYERRPLKVLTITNGDGRRNKPVILIDGTVHAREWISPSMALYIIQQLL-DNYGDNQE 129

  Fly   199 IAQNVDWYIIPVLNTDGFAYSHEVERLWRKSRLP-SDPTGECIGTDLNRNFDYLW-MLTGAESDP 261
            :.|:.||.|:||:|.||:.|:|...|.|||||.| |:|  ||||||:||||.|.| ...|:.|||
  Fly   130 LLQDYDWVIMPVVNADGYEYTHTDSRYWRKSRRPTSNP--ECIGTDINRNFGYEWGHDEGSSSDP 192

  Fly   262 CSQLYAGPSPESDPEISQLTAYINNSIPEGTIKIYISLHSYGQYVLSPWGHTALEFPEHYPQMMH 326
            |..:|.|..|....|...|...:.:.  :|.:..|:||||||.|.|.|||:|: :||:.|..||.
  Fly   193 CENIYRGERPFDQSESQVLRDVMLHY--KGRLNFYLSLHSYGNYFLLPWGYTS-DFPDTYQDMMS 254

  Fly   327 VAKGFSDALYRRYGTVFTYGSSATTLYEVSGSGKEWAYAVKNIKIHYTIELRDKGELGFVLPPED 391
            ||...:.|:......:::|||:...||..||...::|:.|.|..:..|:||...|..||     |
  Fly   255 VADAGAKAIIYSTNGIYSYGSTYYVLYPTSGDTTDFAFGVVNATVAMTMELPAAGFQGF-----D 314

  Fly   392 --IIPVAREVTEGFVGMIAAAREI 413
              |..:.|.|||.:||:.|.|.|:
  Fly   315 PWISQIERLVTESWVGVRAMAAEV 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14820NP_648060.1 Propep_M14 31..100 CDD:280416 2/19 (11%)
M14_CP_A-B_like 115..410 CDD:199844 118/301 (39%)
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 119/304 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466996
Domainoid 1 1.000 158 1.000 Domainoid score I1007
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 1 1.000 - - otm46992
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.