DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14820 and CG31019

DIOPT Version :9

Sequence 1:NP_648060.1 Gene:CG14820 / 38754 FlyBaseID:FBgn0035718 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_733391.1 Gene:CG31019 / 318558 FlyBaseID:FBgn0051019 Length:659 Species:Drosophila melanogaster


Alignment Length:392 Identity:70/392 - (17%)
Similarity:129/392 - (32%) Gaps:132/392 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GLFGLARSVEQVRYD----------------NYKVYNVRIDDLEQFKLLH-TQERSL-------- 49
            |..|.|..|.:..||                |:.|.||:.|....|.::: ::.|:|        
  Fly    62 GNLGKAELVGEFEYDLFLRPDTCNPRFRFWFNFTVDNVKQDQRVLFHIVNISKSRNLFSSGLTPL 126

  Fly    50 -KLSS--------------WREARHLGESSDIMLPPEYQKTFESLLTKHNFTYNLKIDNVQTHID 99
             |.||              :|.|.|.|         .|..:|..:..|....|..          
  Fly   127 VKSSSRPKWQRLSKRQVFFYRSAMHQG---------HYVLSFAFIFDKEEDVYQF---------- 172

  Fly   100 AQRPKQRITSMEWTQFHTLEEIYAWLDVIEDRY--PDIVTPFTIGNSYEGRPIRGVKISYKEGNP 162
                     ::.|.  ::...:.::|:||:.|.  ....|...:..|.:.|.:..:.|.:.....
  Fly   173 ---------ALAWP--YSYSRLQSYLNVIDARQGSDKRFTRCVLVKSLQNRNVDLLTIDHVTAKQ 226

  Fly   163 ------------AVFIESNIHAREWITSATITYFIDELLVPRNPAVRDIAQNVDWYIIPVLNTDG 215
                        .:.:....|:.| ..::.:...:.|.||..:|....:..|..:.|:|::|.||
  Fly   227 RSTNRLDRSFIRVIVVLCRTHSSE-APASHVCQGLIEFLVGNHPIAAVLRDNFVFKIVPMVNPDG 290

  Fly   216 FAYSHEVERLWRKSRLPSDPTGEC--IGTDLNRNFDYLWMLTGAESDPCSQLYAGPSPESD-PEI 277
            ....:                ..|  :|.|:|||    |.:....:.|......|...|.| .::
  Fly   291 VFLGN----------------NRCNLMGQDMNRN----WHIGSEFTQPELHAVKGMLKELDNSDV 335

  Fly   278 SQ-----------LTAYINNSIPEGTIKIYISLHS----YGQYVLSPWGHT---ALEFPEH--YP 322
            |:           :.:| |.|.....|...|.||:    :|.::   :|:|   ...:..|  :|
  Fly   336 SRGIETDLIGIIFVCSY-NISFQTYQIDFVIDLHANSSMHGCFI---YGNTYEDVYRYERHLVFP 396

  Fly   323 QM 324
            ::
  Fly   397 RL 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14820NP_648060.1 Propep_M14 31..100 CDD:280416 16/92 (17%)
M14_CP_A-B_like 115..410 CDD:199844 44/247 (18%)
CG31019NP_733391.1 M14_AGBL4_like 190..478 CDD:133118 42/234 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.